BLASTX nr result
ID: Ophiopogon23_contig00029882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029882 (681 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010918110.1| PREDICTED: single-stranded DNA-binding prote... 125 5e-48 ref|XP_020274893.1| single-stranded DNA-binding protein, mitocho... 114 2e-47 dbj|BAK06246.1| predicted protein [Hordeum vulgare subsp. vulgare] 105 3e-40 ref|XP_020578225.1| LOW QUALITY PROTEIN: single-stranded DNA-bin... 103 1e-39 ref|XP_020157751.1| single-stranded DNA-binding protein, mitocho... 105 1e-39 gb|EEC79506.1| hypothetical protein OsI_20574 [Oryza sativa Indi... 105 3e-39 ref|XP_015637828.1| PREDICTED: single-stranded DNA-binding prote... 105 3e-39 ref|XP_015692792.1| PREDICTED: single-stranded DNA-binding prote... 106 6e-39 ref|XP_006654625.1| PREDICTED: single-stranded DNA-binding prote... 106 6e-39 gb|PAN18651.1| hypothetical protein PAHAL_C02350 [Panicum hallii... 101 8e-39 ref|XP_009417096.1| PREDICTED: single-stranded DNA-binding prote... 113 9e-39 gb|OEL25402.1| Single-stranded DNA-binding protein, mitochondria... 103 1e-38 ref|XP_023912761.1| single-stranded DNA-binding protein, mitocho... 103 4e-38 ref|XP_011628681.1| single-stranded DNA-binding protein, mitocho... 103 7e-38 gb|PKU76426.1| Anaphase-promoting complex subunit 8 [Dendrobium ... 104 8e-38 gb|OAY78945.1| Single-stranded DNA-binding protein, mitochondria... 99 8e-38 ref|XP_021302640.1| single-stranded DNA-binding protein, mitocho... 96 1e-37 ref|XP_004961560.1| single-stranded DNA-binding protein, mitocho... 99 5e-37 gb|PIA61227.1| hypothetical protein AQUCO_00300627v1 [Aquilegia ... 106 6e-37 ref|XP_002278555.1| PREDICTED: single-stranded DNA-binding prote... 97 7e-37 >ref|XP_010918110.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial isoform X1 [Elaeis guineensis] ref|XP_010918111.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial isoform X1 [Elaeis guineensis] ref|XP_010918112.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial isoform X1 [Elaeis guineensis] ref|XP_019705226.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial isoform X1 [Elaeis guineensis] Length = 205 Score = 125 bits (313), Expect(3) = 5e-48 Identities = 54/71 (76%), Positives = 66/71 (92%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIEDDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAP 182 SQSW++T++ DE+EEK+ IEDDDFI+E++ LEPQGVDPKKGWGFRGVHKAI+CGK+ Q P Sbjct: 29 SQSWHSTMSFDEYEEKNDIEDDDFIDEKRGLEPQGVDPKKGWGFRGVHKAIICGKIGQTP 88 Query: 183 VQKILRNGRTV 215 VQKILRNGRT+ Sbjct: 89 VQKILRNGRTI 99 Score = 75.5 bits (184), Expect(3) = 5e-48 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGMYDQR +G LPRPAQWHRI VHNE+LGAY+VQQL+K Sbjct: 105 GTGGMYDQRIIGAEHLPRPAQWHRIVVHNEHLGAYAVQQLVK 146 Score = 40.4 bits (93), Expect(3) = 5e-48 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 KVRL KSGD +NISLDELR GLF Sbjct: 182 KVRLVKSGDSATNISLDELREGLF 205 >ref|XP_020274893.1| single-stranded DNA-binding protein, mitochondrial [Asparagus officinalis] ref|XP_020274894.1| single-stranded DNA-binding protein, mitochondrial [Asparagus officinalis] gb|ONK65034.1| uncharacterized protein A4U43_C07F32800 [Asparagus officinalis] Length = 204 Score = 114 bits (286), Expect(3) = 2e-47 Identities = 52/70 (74%), Positives = 59/70 (84%) Frame = +3 Query: 6 QSWYNTVTSDEFEEKDGIEDDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAPV 185 QSWY+T T DE + + IEDDDF +KELEPQGVDPKKGW FRGVHKAI+CGKV Q+PV Sbjct: 29 QSWYSTTTFDESDVNNEIEDDDFATGKKELEPQGVDPKKGWNFRGVHKAIICGKVGQSPV 88 Query: 186 QKILRNGRTV 215 QKILRNG+TV Sbjct: 89 QKILRNGQTV 98 Score = 82.8 bits (203), Expect(3) = 2e-47 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 221 TGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMKE 346 TGGMYDQR VGGA LPRPAQWHRI +HNEYLGAYSVQQLMK+ Sbjct: 105 TGGMYDQRIVGGAHLPRPAQWHRIVIHNEYLGAYSVQQLMKD 146 Score = 41.6 bits (96), Expect(3) = 2e-47 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 KVRL KSGD SNISLDELR+GLF Sbjct: 181 KVRLIKSGDSASNISLDELRDGLF 204 >dbj|BAK06246.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 206 Score = 105 bits (262), Expect(3) = 3e-40 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 1/72 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIEDD-DFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 S++W +TV+ + +EKD + DD D + R+ELEPQ VDPKKGWGFRGVH+AI+CGKV QA Sbjct: 29 SRAWSSTVSFSDIDEKDDMGDDGDLKDSRRELEPQSVDPKKGWGFRGVHRAIICGKVGQA 88 Query: 180 PVQKILRNGRTV 215 PVQKILRNGRTV Sbjct: 89 PVQKILRNGRTV 100 Score = 70.5 bits (171), Expect(3) = 3e-40 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G A P+PAQWHRI+VH+E+LGAY+VQ+L+K Sbjct: 106 GTGGMFDQRVIGSADTPKPAQWHRIAVHSEHLGAYAVQKLVK 147 Score = 38.9 bits (89), Expect(3) = 3e-40 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSG+ +NISLDELR+GLF Sbjct: 183 KIRLVKSGESAANISLDELRDGLF 206 >ref|XP_020578225.1| LOW QUALITY PROTEIN: single-stranded DNA-binding protein, mitochondrial [Phalaenopsis equestris] Length = 307 Score = 103 bits (258), Expect(3) = 1e-39 Identities = 43/57 (75%), Positives = 55/57 (96%) Frame = +3 Query: 45 EKDGIEDDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAPVQKILRNGRTV 215 +K+ IEDDDF++++KE+EPQGVDP+KGWGFRGVHKAI+CGK+ QAPVQKILRNG+T+ Sbjct: 145 DKNEIEDDDFLSDQKEIEPQGVDPRKGWGFRGVHKAIICGKIGQAPVQKILRNGKTI 201 Score = 74.3 bits (181), Expect(3) = 1e-39 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR VG LPRPAQWHRI+VHNE LGAYSVQQL K Sbjct: 207 GTGGMFDQRIVGNENLPRPAQWHRITVHNENLGAYSVQQLAK 248 Score = 34.3 bits (77), Expect(3) = 1e-39 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 KV L KSGD S I+L++LRNG+F Sbjct: 284 KVHLIKSGDSASEINLNDLRNGIF 307 >ref|XP_020157751.1| single-stranded DNA-binding protein, mitochondrial-like [Aegilops tauschii subsp. tauschii] Length = 206 Score = 105 bits (261), Expect(3) = 1e-39 Identities = 48/72 (66%), Positives = 60/72 (83%), Gaps = 1/72 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIEDD-DFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 S++W +TV+ + +EKD + DD D + R+ELEPQ VDPKKGWGFRGVH+AI+CGKV QA Sbjct: 29 SRAWSSTVSFSDIDEKDDMGDDGDLKDSRRELEPQSVDPKKGWGFRGVHRAIICGKVGQA 88 Query: 180 PVQKILRNGRTV 215 PVQKILRNGRT+ Sbjct: 89 PVQKILRNGRTI 100 Score = 70.5 bits (171), Expect(3) = 1e-39 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G A P+PAQWHRI+VH+E+LGAY+VQ+L+K Sbjct: 106 GTGGMFDQRVIGSADTPKPAQWHRIAVHSEHLGAYAVQKLVK 147 Score = 37.0 bits (84), Expect(3) = 1e-39 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSG+ ++ISLDELR+GLF Sbjct: 183 KIRLVKSGESAASISLDELRDGLF 206 >gb|EEC79506.1| hypothetical protein OsI_20574 [Oryza sativa Indica Group] gb|EEE64314.1| hypothetical protein OsJ_19151 [Oryza sativa Japonica Group] Length = 245 Score = 105 bits (261), Expect(3) = 3e-39 Identities = 49/77 (63%), Positives = 60/77 (77%), Gaps = 1/77 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 SQ+W +TV+ + +EK + DDD+ + R+ELEPQ VDPKKGWGFRGVH+AI+CGKV Q Sbjct: 68 SQAWSSTVSFSDIDEKSEMGGDDDYTDSRRELEPQSVDPKKGWGFRGVHRAIICGKVGQV 127 Query: 180 PVQKILRNGRTVMELVV 230 PVQKILRNGRTV V Sbjct: 128 PVQKILRNGRTVTVFTV 144 Score = 70.1 bits (170), Expect(3) = 3e-39 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR VG A LP+PAQWHRI++HN+ LGA++VQ+L+K Sbjct: 145 GTGGMFDQRVVGDADLPKPAQWHRIAIHNDQLGAFAVQKLVK 186 Score = 36.2 bits (82), Expect(3) = 3e-39 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSG+ ++ISLDELR GLF Sbjct: 222 KIRLIKSGESAASISLDELREGLF 245 >ref|XP_015637828.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Oryza sativa Japonica Group] gb|AAT44275.1| putative single-strand DNA binding protein [Oryza sativa Japonica Group] dbj|BAF17918.1| Os05g0509700 [Oryza sativa Japonica Group] dbj|BAG93436.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS94828.1| Os05g0509700 [Oryza sativa Japonica Group] Length = 206 Score = 105 bits (261), Expect(3) = 3e-39 Identities = 49/77 (63%), Positives = 60/77 (77%), Gaps = 1/77 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 SQ+W +TV+ + +EK + DDD+ + R+ELEPQ VDPKKGWGFRGVH+AI+CGKV Q Sbjct: 29 SQAWSSTVSFSDIDEKSEMGGDDDYTDSRRELEPQSVDPKKGWGFRGVHRAIICGKVGQV 88 Query: 180 PVQKILRNGRTVMELVV 230 PVQKILRNGRTV V Sbjct: 89 PVQKILRNGRTVTVFTV 105 Score = 70.1 bits (170), Expect(3) = 3e-39 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR VG A LP+PAQWHRI++HN+ LGA++VQ+L+K Sbjct: 106 GTGGMFDQRVVGDADLPKPAQWHRIAIHNDQLGAFAVQKLVK 147 Score = 36.2 bits (82), Expect(3) = 3e-39 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSG+ ++ISLDELR GLF Sbjct: 183 KIRLIKSGESAASISLDELREGLF 206 >ref|XP_015692792.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial-like isoform X1 [Oryza brachyantha] Length = 212 Score = 106 bits (265), Expect(3) = 6e-39 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 1/72 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIEDD-DFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 SQ+W +TV+ + +EK+ I DD D+ + R+ELEPQ VDPKKGWGFRGVH+AI+CGKV Q Sbjct: 35 SQAWSSTVSFSDLDEKNDIGDDGDYTDSRRELEPQSVDPKKGWGFRGVHRAIICGKVGQV 94 Query: 180 PVQKILRNGRTV 215 PVQKILRNGRTV Sbjct: 95 PVQKILRNGRTV 106 Score = 67.4 bits (163), Expect(3) = 6e-39 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR G LP+PAQWHRI+VHN+ LGA++VQ+L+K Sbjct: 112 GTGGMFDQRLAGDDTLPKPAQWHRIAVHNDQLGAFAVQKLVK 153 Score = 36.2 bits (82), Expect(3) = 6e-39 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSG+ ++ISLDELR GLF Sbjct: 189 KIRLIKSGESAASISLDELREGLF 212 >ref|XP_006654625.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial-like isoform X2 [Oryza brachyantha] Length = 206 Score = 106 bits (265), Expect(3) = 6e-39 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 1/72 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIEDD-DFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 SQ+W +TV+ + +EK+ I DD D+ + R+ELEPQ VDPKKGWGFRGVH+AI+CGKV Q Sbjct: 29 SQAWSSTVSFSDLDEKNDIGDDGDYTDSRRELEPQSVDPKKGWGFRGVHRAIICGKVGQV 88 Query: 180 PVQKILRNGRTV 215 PVQKILRNGRTV Sbjct: 89 PVQKILRNGRTV 100 Score = 67.4 bits (163), Expect(3) = 6e-39 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR G LP+PAQWHRI+VHN+ LGA++VQ+L+K Sbjct: 106 GTGGMFDQRLAGDDTLPKPAQWHRIAVHNDQLGAFAVQKLVK 147 Score = 36.2 bits (82), Expect(3) = 6e-39 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSG+ ++ISLDELR GLF Sbjct: 183 KIRLIKSGESAASISLDELREGLF 206 >gb|PAN18651.1| hypothetical protein PAHAL_C02350 [Panicum hallii] gb|PAN18652.1| hypothetical protein PAHAL_C02350 [Panicum hallii] gb|PAN18653.1| hypothetical protein PAHAL_C02350 [Panicum hallii] gb|PAN18655.1| hypothetical protein PAHAL_C02350 [Panicum hallii] gb|PAN18657.1| hypothetical protein PAHAL_C02350 [Panicum hallii] gb|PAN18658.1| hypothetical protein PAHAL_C02350 [Panicum hallii] Length = 206 Score = 101 bits (252), Expect(3) = 8e-39 Identities = 46/77 (59%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 SQ+W +TV+ + +EK ++ D+D+ + ++EL+PQ VDPKKGWGFRGVH+AI+CGKV Q Sbjct: 29 SQAWSSTVSFSDLDEKGDMDFDNDYTDSKRELQPQTVDPKKGWGFRGVHRAIICGKVGQV 88 Query: 180 PVQKILRNGRTVMELVV 230 PVQKILRNGRTV V Sbjct: 89 PVQKILRNGRTVTVFTV 105 Score = 68.6 bits (166), Expect(3) = 8e-39 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G LP+PAQWHRI+VH+++LGAY+VQ+L+K Sbjct: 106 GTGGMFDQRVIGPEDLPKPAQWHRIAVHSDHLGAYAVQKLVK 147 Score = 39.7 bits (91), Expect(3) = 8e-39 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSGD NISLDELR GLF Sbjct: 183 KIRLVKSGDSAGNISLDELREGLF 206 >ref|XP_009417096.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Musa acuminata subsp. malaccensis] ref|XP_009417097.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Musa acuminata subsp. malaccensis] ref|XP_009417098.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Musa acuminata subsp. malaccensis] ref|XP_018686897.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Musa acuminata subsp. malaccensis] Length = 203 Score = 113 bits (283), Expect(2) = 9e-39 Identities = 51/71 (71%), Positives = 64/71 (90%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIEDDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAP 182 SQ+ +T+ DE++EK+ IEDD+FI+++KELEPQGVDP KGWGFRGVHKAI+CGK+ QAP Sbjct: 31 SQACLSTMPFDEYKEKNEIEDDNFIDDKKELEPQGVDPIKGWGFRGVHKAIICGKIGQAP 90 Query: 183 VQKILRNGRTV 215 VQKILRNG+TV Sbjct: 91 VQKILRNGKTV 101 Score = 75.5 bits (184), Expect(2) = 9e-39 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGMYDQR G LPRPAQWHRI+VHNE+LGAYSVQQL K Sbjct: 107 GTGGMYDQRITGAEHLPRPAQWHRIAVHNEWLGAYSVQQLEK 148 >gb|OEL25402.1| Single-stranded DNA-binding protein, mitochondrial [Dichanthelium oligosanthes] Length = 211 Score = 103 bits (256), Expect(3) = 1e-38 Identities = 47/77 (61%), Positives = 60/77 (77%), Gaps = 1/77 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 S++W +TV+ + +EK I DDD+ + ++EL+PQ VDPKKGWGFRGVH+AI+CGKV Q Sbjct: 27 SRTWSSTVSFSDLDEKGDINSDDDYTDSKRELQPQSVDPKKGWGFRGVHRAIICGKVGQV 86 Query: 180 PVQKILRNGRTVMELVV 230 PVQKILRNGRTV V Sbjct: 87 PVQKILRNGRTVTVFTV 103 Score = 73.9 bits (180), Expect(3) = 1e-38 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G A LP+PAQWHRI+VHN+YLGAY+VQ+L+K Sbjct: 104 GTGGMFDQRIIGPADLPKPAQWHRIAVHNDYLGAYAVQKLVK 145 Score = 32.0 bits (71), Expect(3) = 1e-38 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDEL 404 K+RL KSGD +NISLDEL Sbjct: 181 KIRLVKSGDSAANISLDEL 199 >ref|XP_023912761.1| single-stranded DNA-binding protein, mitochondrial [Quercus suber] gb|POF10106.1| single-stranded dna-binding protein, mitochondrial [Quercus suber] Length = 213 Score = 103 bits (256), Expect(3) = 4e-38 Identities = 48/76 (63%), Positives = 63/76 (82%), Gaps = 5/76 (6%) Frame = +3 Query: 3 SQSWYNTVTSD---EFEEKDGIEDD--DFINERKELEPQGVDPKKGWGFRGVHKAIVCGK 167 S+SWY+T++ D + +KDG+E+D D + ++ EL+PQGVDP++GWGFRGVHKAI+CGK Sbjct: 32 SKSWYSTMSFDGDNDGGKKDGLEEDFDDLLGDKTELQPQGVDPRRGWGFRGVHKAIICGK 91 Query: 168 VRQAPVQKILRNGRTV 215 V QAPVQKILRNGR V Sbjct: 92 VGQAPVQKILRNGRMV 107 Score = 71.2 bits (173), Expect(3) = 4e-38 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR VG LP+PAQWHRI+VHNE LGAY+VQQL+K Sbjct: 113 GTGGMFDQRIVGTKDLPKPAQWHRIAVHNEPLGAYAVQQLVK 154 Score = 33.1 bits (74), Expect(3) = 4e-38 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGL 416 K+RL K+G+ +S+ISLD+LR GL Sbjct: 190 KIRLIKTGESLSSISLDDLREGL 212 >ref|XP_011628681.1| single-stranded DNA-binding protein, mitochondrial [Amborella trichopoda] Length = 200 Score = 103 bits (256), Expect(3) = 7e-38 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 1/69 (1%) Frame = +3 Query: 12 WYNTVTSDEFEEKDG-IEDDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAPVQ 188 W++T++ DE+E G ++D+DFI + EL+PQGVDPK+GW FRGVHKAI+CGK+ Q PVQ Sbjct: 26 WHSTMSFDEYENSHGDLKDEDFIPNKGELQPQGVDPKRGWAFRGVHKAIICGKIGQPPVQ 85 Query: 189 KILRNGRTV 215 KILRNGRTV Sbjct: 86 KILRNGRTV 94 Score = 73.2 bits (178), Expect(3) = 7e-38 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G LPRPAQWHRI+VHNE LGAY+VQQL+K Sbjct: 100 GTGGMFDQRILGSEHLPRPAQWHRIAVHNEQLGAYAVQQLVK 141 Score = 30.4 bits (67), Expect(3) = 7e-38 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K++L K+ SNISLDELR GLF Sbjct: 177 KLQLIKAVADASNISLDELREGLF 200 >gb|PKU76426.1| Anaphase-promoting complex subunit 8 [Dendrobium catenatum] Length = 1338 Score = 104 bits (260), Expect(3) = 8e-38 Identities = 47/66 (71%), Positives = 58/66 (87%) Frame = +3 Query: 18 NTVTSDEFEEKDGIEDDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAPVQKIL 197 +T T D F K+ IEDDDF+ ++KE+EPQGVDP+KGWGFRGVHKAI+CGK+ QAPVQKIL Sbjct: 1147 STTTFDAFA-KNEIEDDDFLYDQKEIEPQGVDPRKGWGFRGVHKAIICGKIGQAPVQKIL 1205 Query: 198 RNGRTV 215 RNG+T+ Sbjct: 1206 RNGKTI 1211 Score = 74.3 bits (181), Expect(3) = 8e-38 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR VG LPRPAQWHRI+VHNE LGAYSVQQL K Sbjct: 1217 GTGGMFDQRIVGNENLPRPAQWHRITVHNETLGAYSVQQLAK 1258 Score = 27.3 bits (59), Expect(3) = 8e-38 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELR 407 KVRL KSGD S I+L++L+ Sbjct: 1294 KVRLIKSGDSASEINLNDLK 1313 >gb|OAY78945.1| Single-stranded DNA-binding protein, mitochondrial [Ananas comosus] Length = 239 Score = 99.0 bits (245), Expect(3) = 8e-38 Identities = 44/71 (61%), Positives = 59/71 (83%), Gaps = 1/71 (1%) Frame = +3 Query: 6 QSWYNTVTSDEFEEKDGIEDDDF-INERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQAP 182 ++W +T++ DEF EK+ ++DDD I +++ LEPQ VDPKKGW FRGVHKAI+CGK+ Q P Sbjct: 40 KAWNSTMSFDEFAEKNDMDDDDDPIVDKRNLEPQSVDPKKGWNFRGVHKAIICGKIGQPP 99 Query: 183 VQKILRNGRTV 215 +QKILRNG+TV Sbjct: 100 LQKILRNGKTV 110 Score = 76.3 bits (186), Expect(3) = 8e-38 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +GG LPRPAQWHRI+VHNE LGAY+VQQL+K Sbjct: 116 GTGGMFDQRIIGGENLPRPAQWHRIAVHNEQLGAYAVQQLVK 157 Score = 31.2 bits (69), Expect(3) = 8e-38 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELR 407 KVRL KSGD S+ISLDEL+ Sbjct: 193 KVRLIKSGDVASSISLDELK 212 >ref|XP_021302640.1| single-stranded DNA-binding protein, mitochondrial [Sorghum bicolor] ref|XP_021302641.1| single-stranded DNA-binding protein, mitochondrial [Sorghum bicolor] ref|XP_021302642.1| single-stranded DNA-binding protein, mitochondrial [Sorghum bicolor] gb|KXG22311.1| hypothetical protein SORBI_3009G191800 [Sorghum bicolor] gb|KXG22312.1| hypothetical protein SORBI_3009G191800 [Sorghum bicolor] gb|KXG22313.1| hypothetical protein SORBI_3009G191800 [Sorghum bicolor] gb|KXG22314.1| hypothetical protein SORBI_3009G191800 [Sorghum bicolor] gb|OQU78273.1| hypothetical protein SORBI_3009G191800 [Sorghum bicolor] Length = 206 Score = 96.3 bits (238), Expect(3) = 1e-37 Identities = 46/77 (59%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 SQ W +TV+ +F+EK +E DD+ + ++EL PQ VDPKKGW FRGVH+AI+CGKV Q Sbjct: 29 SQVWSSTVSFSDFDEKGDMEYDDNSPDSKRELRPQSVDPKKGWEFRGVHRAIICGKVGQV 88 Query: 180 PVQKILRNGRTVMELVV 230 PVQKILRNG TV V Sbjct: 89 PVQKILRNGHTVTVFTV 105 Score = 69.3 bits (168), Expect(3) = 1e-37 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G LP+PAQWHRI+VHN+ LGAY+VQ+L+K Sbjct: 106 GTGGMFDQRVIGPKDLPKPAQWHRIAVHNDQLGAYAVQKLVK 147 Score = 40.4 bits (93), Expect(3) = 1e-37 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSGD +NISLDELR+GLF Sbjct: 183 KIRLVKSGDSAANISLDELRDGLF 206 >ref|XP_004961560.1| single-stranded DNA-binding protein, mitochondrial [Setaria italica] ref|XP_004961561.1| single-stranded DNA-binding protein, mitochondrial [Setaria italica] ref|XP_014660309.1| single-stranded DNA-binding protein, mitochondrial [Setaria italica] gb|KQL14798.1| hypothetical protein SETIT_023262mg [Setaria italica] Length = 206 Score = 98.6 bits (244), Expect(3) = 5e-37 Identities = 44/77 (57%), Positives = 59/77 (76%), Gaps = 1/77 (1%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGKVRQA 179 S++W +TV+ + +EK ++ DDD+ + ++EL+P VDPKKGW FRGVH+AI+CGKV Q Sbjct: 29 SRAWSSTVSFSDLDEKGDMDIDDDYTDSKRELQPHSVDPKKGWAFRGVHRAIICGKVGQV 88 Query: 180 PVQKILRNGRTVMELVV 230 PVQKILRNGRTV V Sbjct: 89 PVQKILRNGRTVTVFTV 105 Score = 67.8 bits (164), Expect(3) = 5e-37 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +G LP+PAQWHRI+VHN+ LGAY VQ+L+K Sbjct: 106 GTGGMFDQRVIGPEDLPKPAQWHRIAVHNDRLGAYVVQKLVK 147 Score = 37.4 bits (85), Expect(3) = 5e-37 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 K+RL KSGD +NISLD LR GLF Sbjct: 183 KIRLVKSGDSAANISLDGLREGLF 206 >gb|PIA61227.1| hypothetical protein AQUCO_00300627v1 [Aquilegia coerulea] Length = 207 Score = 106 bits (265), Expect(2) = 6e-37 Identities = 49/77 (63%), Positives = 61/77 (79%), Gaps = 6/77 (7%) Frame = +3 Query: 3 SQSWYNTVTSDEFEEKDGIED------DDFINERKELEPQGVDPKKGWGFRGVHKAIVCG 164 S W++TV+ D+ E+ +++ DDFI +KELEPQGVDPK+GWGFRGVHKAI+CG Sbjct: 29 SVMWHSTVSFDDDEDNGDVDNSAELDCDDFITNKKELEPQGVDPKRGWGFRGVHKAIICG 88 Query: 165 KVRQAPVQKILRNGRTV 215 K+ QAPVQKILRNGRTV Sbjct: 89 KIGQAPVQKILRNGRTV 105 Score = 76.3 bits (186), Expect(2) = 6e-37 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGMYDQR +G LP+PAQWHR++VHNE+LGAYSVQQL+K Sbjct: 111 GTGGMYDQRIIGSQNLPKPAQWHRVAVHNEHLGAYSVQQLVK 152 >ref|XP_002278555.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Vitis vinifera] emb|CBI39559.3| unnamed protein product, partial [Vitis vinifera] Length = 208 Score = 96.7 bits (239), Expect(3) = 7e-37 Identities = 47/76 (61%), Positives = 60/76 (78%), Gaps = 5/76 (6%) Frame = +3 Query: 3 SQSWYNTVTSD----EFEEKDGIE-DDDFINERKELEPQGVDPKKGWGFRGVHKAIVCGK 167 S++WY+TV+ D + + +G E D+D + E+ L+ QGVDP+KGWGFRGVHKAI+CGK Sbjct: 27 SKAWYSTVSFDGGDGDGKNGEGEESDNDLVTEKPNLQLQGVDPRKGWGFRGVHKAIICGK 86 Query: 168 VRQAPVQKILRNGRTV 215 V QAPVQKILRNGRTV Sbjct: 87 VGQAPVQKILRNGRTV 102 Score = 69.7 bits (169), Expect(3) = 7e-37 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 218 GTGGMYDQRTVGGALLPRPAQWHRISVHNEYLGAYSVQQLMK 343 GTGGM+DQR +GG LP+PAQWHRI+VHNE LGAY+VQQL+K Sbjct: 108 GTGGMFDQR-IGGKDLPKPAQWHRIAVHNEPLGAYAVQQLVK 148 Score = 37.0 bits (84), Expect(3) = 7e-37 Identities = 15/24 (62%), Positives = 21/24 (87%) Frame = +3 Query: 348 KVRLTKSGDRVSNISLDELRNGLF 419 ++RL K+G+ +SNIS+DELR GLF Sbjct: 184 RIRLIKTGESISNISVDELREGLF 207