BLASTX nr result
ID: Ophiopogon23_contig00029874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029874 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253051.1| survival of motor neuron-related-splicing fa... 100 5e-23 ref|XP_020245548.1| survival of motor neuron-related-splicing fa... 96 2e-21 ref|XP_020245547.1| survival of motor neuron-related-splicing fa... 96 4e-21 gb|KZV48187.1| survival of motor neuron-related-splicing factor ... 86 6e-19 emb|CDO97657.1| unnamed protein product [Coffea canephora] 88 2e-18 gb|PKI50273.1| hypothetical protein CRG98_029346 [Punica granatum] 86 4e-18 ref|XP_010682128.1| PREDICTED: survival of motor neuron-related-... 87 6e-18 ref|XP_021762070.1| survival of motor neuron-related-splicing fa... 87 6e-18 ref|XP_021720185.1| survival of motor neuron-related-splicing fa... 87 6e-18 ref|XP_021843925.1| survival of motor neuron-related-splicing fa... 87 6e-18 gb|KGN51397.1| hypothetical protein Csa_5G526870 [Cucumis sativus] 84 8e-18 ref|XP_011092257.1| survival of motor neuron-related-splicing fa... 86 1e-17 ref|XP_019264517.1| PREDICTED: survival of motor neuron-related-... 85 1e-17 ref|XP_016483327.1| PREDICTED: survival of motor neuron-related-... 85 1e-17 gb|OWM79301.1| hypothetical protein CDL15_Pgr003474 [Punica gran... 86 1e-17 ref|XP_019169510.1| PREDICTED: survival of motor neuron-related-... 86 1e-17 ref|XP_011092256.1| survival of motor neuron-related-splicing fa... 86 2e-17 gb|KCW57169.1| hypothetical protein EUGRSUZ_I02797 [Eucalyptus g... 85 2e-17 ref|XP_010030231.1| PREDICTED: survival of motor neuron-related-... 85 2e-17 gb|KJB66536.1| hypothetical protein B456_010G142900 [Gossypium r... 84 2e-17 >ref|XP_020253051.1| survival of motor neuron-related-splicing factor 30-like [Asparagus officinalis] gb|ONK77384.1| uncharacterized protein A4U43_C02F5970 [Asparagus officinalis] Length = 301 Score = 100 bits (249), Expect = 5e-23 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSEAQE 173 F SGRKRESIFKSPDDP G+VGVTNSGKGLTDFQRREKYLQLKGANMD+E QE Sbjct: 249 FFSGRKRESIFKSPDDPYGKVGVTNSGKGLTDFQRREKYLQLKGANMDNEDQE 301 >ref|XP_020245548.1| survival of motor neuron-related-splicing factor 30-like isoform X2 [Asparagus officinalis] Length = 256 Score = 95.5 bits (236), Expect = 2e-21 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSE 182 F SGRKR+SIFKSPDDP G+VGVTNSGKGLTDFQRREKYLQLKGAN+D+E Sbjct: 205 FFSGRKRDSIFKSPDDPKGKVGVTNSGKGLTDFQRREKYLQLKGANIDNE 254 >ref|XP_020245547.1| survival of motor neuron-related-splicing factor 30-like isoform X1 [Asparagus officinalis] Length = 299 Score = 95.5 bits (236), Expect = 4e-21 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSE 182 F SGRKR+SIFKSPDDP G+VGVTNSGKGLTDFQRREKYLQLKGAN+D+E Sbjct: 248 FFSGRKRDSIFKSPDDPKGKVGVTNSGKGLTDFQRREKYLQLKGANIDNE 297 >gb|KZV48187.1| survival of motor neuron-related-splicing factor 30, partial [Dorcoceras hygrometricum] Length = 146 Score = 86.3 bits (212), Expect = 6e-19 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSPDDP G+VGVT SGKGLTDFQ+REK+L LKGANM++ Sbjct: 95 FFSGRKRESIFKSPDDPFGKVGVTGSGKGLTDFQKREKHLHLKGANMET 143 >emb|CDO97657.1| unnamed protein product [Coffea canephora] Length = 301 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSPDDPNG+VGVT SGKGLT+FQ+REK+L LKGANM++ Sbjct: 250 FFSGRKRESIFKSPDDPNGKVGVTGSGKGLTEFQKREKHLHLKGANMEA 298 >gb|PKI50273.1| hypothetical protein CRG98_029346 [Punica granatum] Length = 214 Score = 85.9 bits (211), Expect = 4e-18 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSPDDPNG+VGVT SGKGLT+FQ+REK+L LKGAN ++ Sbjct: 163 FFSGRKRESIFKSPDDPNGKVGVTGSGKGLTEFQKREKHLHLKGANSET 211 >ref|XP_010682128.1| PREDICTED: survival of motor neuron-related-splicing factor 30 [Beta vulgaris subsp. vulgaris] gb|KMT07893.1| hypothetical protein BVRB_6g145890 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 87.0 bits (214), Expect = 6e-18 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSEAQE 173 F SGRK++SIFKSPDDP+G+VGVT SGKGLTDFQ+REK+L LKGAN+++E E Sbjct: 254 FFSGRKKDSIFKSPDDPHGKVGVTGSGKGLTDFQKREKHLHLKGANIENETVE 306 >ref|XP_021762070.1| survival of motor neuron-related-splicing factor 30-like [Chenopodium quinoa] Length = 310 Score = 87.0 bits (214), Expect = 6e-18 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSEAQE 173 F SGRK+ESIFKSP+DP G+VGVT SGKGLTDFQ+REK+L LKGAN+D+E E Sbjct: 255 FFSGRKKESIFKSPEDPQGKVGVTGSGKGLTDFQKREKHLHLKGANIDNENGE 307 >ref|XP_021720185.1| survival of motor neuron-related-splicing factor 30-like [Chenopodium quinoa] Length = 311 Score = 87.0 bits (214), Expect = 6e-18 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSEAQE 173 F SGRK+ESIFKSP+DP G+VGVT SGKGLTDFQ+REK+L LKGAN+D+E E Sbjct: 256 FFSGRKKESIFKSPEDPQGKVGVTGSGKGLTDFQKREKHLHLKGANIDNENGE 308 >ref|XP_021843925.1| survival of motor neuron-related-splicing factor 30 [Spinacia oleracea] gb|KNA08830.1| hypothetical protein SOVF_159180 [Spinacia oleracea] Length = 311 Score = 87.0 bits (214), Expect = 6e-18 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSEAQE 173 F SGRK+ESIFKSP+DP G+VGVT SGKGLTDFQ+REK+L LKGAN+D+E E Sbjct: 256 FFSGRKKESIFKSPEDPQGKVGVTGSGKGLTDFQKREKHLHLKGANIDNENGE 308 >gb|KGN51397.1| hypothetical protein Csa_5G526870 [Cucumis sativus] Length = 186 Score = 84.3 bits (207), Expect = 8e-18 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSE 182 F SGRKRESIFKSPDDPNG+VGVT SGKGLT+FQ+REK+L LKGA ++ + Sbjct: 136 FFSGRKRESIFKSPDDPNGKVGVTGSGKGLTEFQKREKHLHLKGATVEMD 185 >ref|XP_011092257.1| survival of motor neuron-related-splicing factor 30-like isoform X2 [Sesamum indicum] Length = 290 Score = 85.9 bits (211), Expect = 1e-17 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSPDDP G+VGVT SGKGLT+FQ+REK+L LKGANM+S Sbjct: 239 FFSGRKRESIFKSPDDPFGKVGVTGSGKGLTEFQKREKHLHLKGANMES 287 >ref|XP_019264517.1| PREDICTED: survival of motor neuron-related-splicing factor 30 isoform X2 [Nicotiana attenuata] Length = 253 Score = 85.1 bits (209), Expect = 1e-17 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSP+DP+G+VGVT SGKGLTDFQRREK+L LKGAN ++ Sbjct: 202 FFSGRKRESIFKSPEDPHGKVGVTGSGKGLTDFQRREKHLHLKGANAEA 250 >ref|XP_016483327.1| PREDICTED: survival of motor neuron-related-splicing factor 30-like isoform X3 [Nicotiana tabacum] ref|XP_018629724.1| PREDICTED: survival of motor neuron-related-splicing factor 30 isoform X2 [Nicotiana tomentosiformis] ref|XP_018629725.1| PREDICTED: survival of motor neuron-related-splicing factor 30 isoform X2 [Nicotiana tomentosiformis] Length = 253 Score = 85.1 bits (209), Expect = 1e-17 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSP+DP+G+VGVT SGKGLTDFQRREK+L LKGAN ++ Sbjct: 202 FFSGRKRESIFKSPEDPHGKVGVTGSGKGLTDFQRREKHLHLKGANAEA 250 >gb|OWM79301.1| hypothetical protein CDL15_Pgr003474 [Punica granatum] Length = 299 Score = 85.9 bits (211), Expect = 1e-17 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSPDDPNG+VGVT SGKGLT+FQ+REK+L LKGAN ++ Sbjct: 248 FFSGRKRESIFKSPDDPNGKVGVTGSGKGLTEFQKREKHLHLKGANSET 296 >ref|XP_019169510.1| PREDICTED: survival of motor neuron-related-splicing factor 30 [Ipomoea nil] Length = 299 Score = 85.9 bits (211), Expect = 1e-17 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDSEAQ 176 F SGRKRESIFKSPDDP G+VGVT SGKGLTDFQ+REK+L LKGAN++ + Sbjct: 248 FFSGRKRESIFKSPDDPTGKVGVTGSGKGLTDFQKREKHLHLKGANIEGSEE 299 >ref|XP_011092256.1| survival of motor neuron-related-splicing factor 30-like isoform X1 [Sesamum indicum] Length = 304 Score = 85.9 bits (211), Expect = 2e-17 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 F SGRKRESIFKSPDDP G+VGVT SGKGLT+FQ+REK+L LKGANM+S Sbjct: 253 FFSGRKRESIFKSPDDPFGKVGVTGSGKGLTEFQKREKHLHLKGANMES 301 >gb|KCW57169.1| hypothetical protein EUGRSUZ_I02797 [Eucalyptus grandis] Length = 259 Score = 85.1 bits (209), Expect = 2e-17 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 FL+GRKRESIFKSPDDP+G+VGVT SGKGLT+FQ+REK+L LKGAN+++ Sbjct: 208 FLTGRKRESIFKSPDDPHGKVGVTGSGKGLTEFQKREKHLHLKGANVEA 256 >ref|XP_010030231.1| PREDICTED: survival of motor neuron-related-splicing factor 30 isoform X3 [Eucalyptus grandis] Length = 260 Score = 85.1 bits (209), Expect = 2e-17 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMDS 185 FL+GRKRESIFKSPDDP+G+VGVT SGKGLT+FQ+REK+L LKGAN+++ Sbjct: 209 FLTGRKRESIFKSPDDPHGKVGVTGSGKGLTEFQKREKHLHLKGANVEA 257 >gb|KJB66536.1| hypothetical protein B456_010G142900 [Gossypium raimondii] gb|KJB66540.1| hypothetical protein B456_010G142900 [Gossypium raimondii] gb|KJB66541.1| hypothetical protein B456_010G142900 [Gossypium raimondii] gb|KJB66542.1| hypothetical protein B456_010G142900 [Gossypium raimondii] gb|KJB66543.1| hypothetical protein B456_010G142900 [Gossypium raimondii] gb|KJB66544.1| hypothetical protein B456_010G142900 [Gossypium raimondii] Length = 208 Score = 84.0 bits (206), Expect = 2e-17 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = -1 Query: 331 FLSGRKRESIFKSPDDPNGRVGVTNSGKGLTDFQRREKYLQLKGANMD 188 F SGRKRESIFKSPDDP G+VGVT SGKGLTDFQ+REK+L LKG N++ Sbjct: 157 FFSGRKRESIFKSPDDPQGKVGVTGSGKGLTDFQKREKHLHLKGGNVE 204