BLASTX nr result
ID: Ophiopogon23_contig00029784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029784 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275509.1| LOW QUALITY PROTEIN: uncharacterized protein... 41 2e-07 gb|ONK62504.1| uncharacterized protein A4U43_C07F4620 [Asparagus... 41 2e-07 >ref|XP_020275509.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109850024 [Asparagus officinalis] Length = 1351 Score = 41.2 bits (95), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +3 Query: 174 MVGMMAASWAERAEILLNLIKDYDGGVVSKIE 269 MVGMMAASW ERAEIL+N +K +SKIE Sbjct: 1 MVGMMAASWRERAEILINSVKS-SSNALSKIE 31 Score = 41.2 bits (95), Expect(2) = 2e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +2 Query: 272 LRQLKKVILVRDPSLLLEFMA*IVELQERAS 364 LRQLK+VILVRD SLL EF+ IVELQE S Sbjct: 33 LRQLKEVILVRDRSLLPEFVPQIVELQEEKS 63 >gb|ONK62504.1| uncharacterized protein A4U43_C07F4620 [Asparagus officinalis] Length = 1085 Score = 41.2 bits (95), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +3 Query: 174 MVGMMAASWAERAEILLNLIKDYDGGVVSKIE 269 MVGMMAASW ERAEIL+N +K +SKIE Sbjct: 1 MVGMMAASWRERAEILINSVKS-SSNALSKIE 31 Score = 41.2 bits (95), Expect(2) = 2e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +2 Query: 272 LRQLKKVILVRDPSLLLEFMA*IVELQERAS 364 LRQLK+VILVRD SLL EF+ IVELQE S Sbjct: 33 LRQLKEVILVRDRSLLPEFVPQIVELQEEKS 63