BLASTX nr result
ID: Ophiopogon23_contig00029325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029325 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247591.1| mechanosensitive ion channel protein 1, mito... 64 3e-09 >ref|XP_020247591.1| mechanosensitive ion channel protein 1, mitochondrial-like [Asparagus officinalis] Length = 547 Score = 64.3 bits (155), Expect = 3e-09 Identities = 42/85 (49%), Positives = 48/85 (56%), Gaps = 16/85 (18%) Frame = +1 Query: 199 RSLYESLRAATDPCSKTRFVRS----------------CASDISTYSKTKDTCWNLLSVG 330 RSLY S+RAA DP KTR +S AS T SK+K+ C + Sbjct: 7 RSLYGSVRAAIDPYCKTRSFKSYASCFRSQRLCSYGLPTASGSCTSSKSKEACGPSWYLD 66 Query: 331 KQNNRTLPLSSVVGIQQLQADSSRK 405 K N+RTLPLSS VGIQQLQADSS K Sbjct: 67 KGNSRTLPLSSFVGIQQLQADSSTK 91