BLASTX nr result
ID: Ophiopogon23_contig00029113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029113 (325 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258791.1| putative F-box/LRR-repeat protein At5g54820 ... 65 4e-10 gb|ONK76026.1| uncharacterized protein A4U43_C03F23060 [Asparagu... 65 4e-10 >ref|XP_020258791.1| putative F-box/LRR-repeat protein At5g54820 [Asparagus officinalis] Length = 544 Score = 65.5 bits (158), Expect = 4e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = +3 Query: 114 LQLSISWQDPDLLRPFNLVELENDPPMPNLENLKIIKLDNFQGYVKEILLVEFLLQNAV 290 ++L SW DPDL L ++ +PP+ NL NLKIIKL+NF+G++ E+ L++FLLQNAV Sbjct: 363 IELPTSWSDPDL----ELDMVQKNPPVLNLRNLKIIKLNNFKGHINELFLLDFLLQNAV 417 >gb|ONK76026.1| uncharacterized protein A4U43_C03F23060 [Asparagus officinalis] Length = 1122 Score = 65.5 bits (158), Expect = 4e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = +3 Query: 114 LQLSISWQDPDLLRPFNLVELENDPPMPNLENLKIIKLDNFQGYVKEILLVEFLLQNAV 290 ++L SW DPDL L ++ +PP+ NL NLKIIKL+NF+G++ E+ L++FLLQNAV Sbjct: 486 IELPTSWSDPDL----ELDMVQKNPPVLNLRNLKIIKLNNFKGHINELFLLDFLLQNAV 540