BLASTX nr result
ID: Ophiopogon23_contig00029098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029098 (716 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254045.1| dual specificity protein phosphatase 1B-like... 64 1e-08 >ref|XP_020254045.1| dual specificity protein phosphatase 1B-like [Asparagus officinalis] Length = 266 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 714 AFELVRSKRPRVQPNYGFMMQLQNFEKSIGVLQDNSG 604 A ELVRSKRP+VQPN GF++QL NFEKS+GVLQDNSG Sbjct: 230 ALELVRSKRPQVQPNLGFVLQLINFEKSLGVLQDNSG 266