BLASTX nr result
ID: Ophiopogon23_contig00028013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028013 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272714.1| splicing factor U2af large subunit A-like [A... 70 4e-12 gb|ONK65298.1| uncharacterized protein A4U43_C07F35690 [Asparagu... 70 2e-11 >ref|XP_020272714.1| splicing factor U2af large subunit A-like [Asparagus officinalis] Length = 232 Score = 70.1 bits (170), Expect = 4e-12 Identities = 49/97 (50%), Positives = 59/97 (60%), Gaps = 10/97 (10%) Frame = +3 Query: 75 LDRDRVRDSVEKERGSHRKQK---XXXXXXXXXXXXXXRKRARA-------RPLKENGGD 224 ++RDRVRDSVE+ER SH +K +KRARA R +E GD Sbjct: 86 VERDRVRDSVERERVSHSSRKRKDHDYDYCDGDEENGDKKRARASDDRKERRRFEEENGD 145 Query: 225 YKVKEEELSGDDAEASSRKRKREGPRFSDAAVRVREE 335 YKVK+EELS D E SRKRKREG RFSD +V+V+EE Sbjct: 146 YKVKDEELS--DVE-GSRKRKREGRRFSD-SVKVKEE 178 >gb|ONK65298.1| uncharacterized protein A4U43_C07F35690 [Asparagus officinalis] Length = 697 Score = 70.1 bits (170), Expect = 2e-11 Identities = 49/97 (50%), Positives = 59/97 (60%), Gaps = 10/97 (10%) Frame = +3 Query: 75 LDRDRVRDSVEKERGSHRKQK---XXXXXXXXXXXXXXRKRARA-------RPLKENGGD 224 ++RDRVRDSVE+ER SH +K +KRARA R +E GD Sbjct: 86 VERDRVRDSVERERVSHSSRKRKDHDYDYCDGDEENGDKKRARASDDRKERRRFEEENGD 145 Query: 225 YKVKEEELSGDDAEASSRKRKREGPRFSDAAVRVREE 335 YKVK+EELS D E SRKRKREG RFSD +V+V+EE Sbjct: 146 YKVKDEELS--DVE-GSRKRKREGRRFSD-SVKVKEE 178