BLASTX nr result
ID: Ophiopogon23_contig00027436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027436 (627 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272038.1| uncharacterized protein LOC109847206 [Aspara... 56 6e-06 >ref|XP_020272038.1| uncharacterized protein LOC109847206 [Asparagus officinalis] Length = 655 Score = 56.2 bits (134), Expect(2) = 6e-06 Identities = 22/59 (37%), Positives = 41/59 (69%) Frame = -1 Query: 177 SIFFFKYFWKLIKPNLMKLMAELDNGWARLDQLNYSHMVIIPKKSASMDIGDYRHIALL 1 S FF+ FW+++K ++M+L E G ++++NY+H+++I KK+ + + DYR I+LL Sbjct: 98 SAIFFQVFWEVVKLDIMRLFEEFYEGKLEINRINYAHIILIQKKNEASTVNDYRPISLL 156 Score = 21.9 bits (45), Expect(2) = 6e-06 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 227 KGYLGVRDRKAPGPDGF 177 K + K+PGPDGF Sbjct: 81 KAIFDMNGDKSPGPDGF 97