BLASTX nr result
ID: Ophiopogon23_contig00027141
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027141 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010918851.1| PREDICTED: ankyrin repeat domain-containing ... 70 1e-10 ref|XP_020259965.1| ankyrin repeat domain-containing protein 13C... 70 1e-10 gb|AGA61019.1| hypothetical protein, partial [Erythranthe geyeri] 65 3e-10 ref|XP_008808444.1| PREDICTED: uncharacterized protein LOC103720... 68 6e-10 ref|XP_010933138.1| PREDICTED: ankyrin repeat domain-containing ... 68 8e-10 ref|XP_010933137.1| PREDICTED: ankyrin repeat domain-containing ... 68 9e-10 ref|XP_020575194.1| ankyrin repeat domain-containing protein 13C... 68 9e-10 gb|AGA60919.1| hypothetical protein, partial [Mimulus sookensis]... 64 1e-09 gb|AGA60918.1| hypothetical protein, partial [Mimulus sookensis]... 64 1e-09 ref|XP_008804748.1| PREDICTED: ankyrin repeat domain-containing ... 67 1e-09 ref|XP_010522417.1| PREDICTED: ankyrin repeat domain-containing ... 67 2e-09 ref|XP_020673000.1| ankyrin repeat domain-containing protein 13C... 66 4e-09 ref|XP_008796417.1| PREDICTED: ankyrin repeat domain-containing ... 66 4e-09 ref|XP_009396014.1| PREDICTED: ankyrin repeat domain-containing ... 65 5e-09 emb|CDO99416.1| unnamed protein product [Coffea canephora] 65 7e-09 ref|XP_023736408.1| ankyrin repeat domain-containing protein 13C... 65 7e-09 ref|XP_022873734.1| uncharacterized protein LOC111392607 [Olea e... 65 1e-08 ref|XP_011091404.1| uncharacterized protein LOC105171856 [Sesamu... 64 2e-08 ref|XP_012844185.1| PREDICTED: uncharacterized protein LOC105964... 64 2e-08 dbj|GAV67556.1| GPCR_chapero_1 domain-containing protein/Ank_2 d... 64 2e-08 >ref|XP_010918851.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Elaeis guineensis] Length = 644 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA ID SKY+HSPVHKAV+A+DYSGL+R+L+SLPRLADP Sbjct: 1 MAGIDVSKYAHSPVHKAVLARDYSGLKRILASLPRLADP 39 >ref|XP_020259965.1| ankyrin repeat domain-containing protein 13C-A [Asparagus officinalis] Length = 654 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA ID SKYSHSPVHKAV+A+DYSGL+R LSSLPRL+DP Sbjct: 1 MAGIDVSKYSHSPVHKAVLARDYSGLKRTLSSLPRLSDP 39 >gb|AGA61019.1| hypothetical protein, partial [Erythranthe geyeri] Length = 113 Score = 65.1 bits (157), Expect = 3e-10 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 M+++D SKY HSPVHKA+I KDY+GLR++++SLPRL DP Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIASLPRLCDP 39 >ref|XP_008808444.1| PREDICTED: uncharacterized protein LOC103720502 [Phoenix dactylifera] Length = 541 Score = 68.2 bits (165), Expect = 6e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA IDA KY+HSPVHKAV+AKDY GL+R+L+SLPRLADP Sbjct: 1 MAGIDAWKYTHSPVHKAVLAKDYIGLKRILASLPRLADP 39 >ref|XP_010933138.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like isoform X2 [Elaeis guineensis] Length = 560 Score = 67.8 bits (164), Expect = 8e-10 Identities = 28/39 (71%), Positives = 38/39 (97%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA IDASKY+HSP+H+AV+A+DY+GL+R+L+S+PRLADP Sbjct: 1 MAGIDASKYTHSPIHQAVLARDYAGLKRILASVPRLADP 39 >ref|XP_010933137.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like isoform X1 [Elaeis guineensis] Length = 646 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/39 (71%), Positives = 38/39 (97%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA IDASKY+HSP+H+AV+A+DY+GL+R+L+S+PRLADP Sbjct: 1 MAGIDASKYTHSPIHQAVLARDYAGLKRILASVPRLADP 39 >ref|XP_020575194.1| ankyrin repeat domain-containing protein 13C-like isoform X1 [Phalaenopsis equestris] Length = 661 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA IDA KY+HSPVHKAV+A+DYSGL+R+L+SLPRL DP Sbjct: 1 MAGIDALKYAHSPVHKAVLARDYSGLKRILASLPRLLDP 39 >gb|AGA60919.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60921.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60922.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60923.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60924.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60925.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60926.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60927.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60929.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60931.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60933.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60934.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60935.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60936.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60937.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60939.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60941.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60942.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60943.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60944.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60945.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60946.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60947.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60948.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60949.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60951.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60953.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60955.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60957.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60958.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60959.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60960.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60961.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60962.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60963.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60964.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60965.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60966.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60967.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60968.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60969.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60970.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60971.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60972.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60973.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60975.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60976.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60977.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60979.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60981.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60982.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60983.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60984.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60985.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60986.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60987.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60988.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA60989.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60990.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60991.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60992.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60993.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60994.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA60995.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60996.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60997.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60998.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60999.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61000.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61001.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61002.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61003.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61004.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61005.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61006.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61007.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61008.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61009.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61010.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61011.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61012.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61013.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61014.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61015.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61016.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61017.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61018.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61020.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61021.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61022.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61023.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61024.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61025.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61026.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61027.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61028.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61029.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61030.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61031.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61032.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61033.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61034.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61035.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61036.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61037.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61038.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61039.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61040.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61041.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61042.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61043.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61044.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61045.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61046.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61047.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61048.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61049.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61050.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61051.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61052.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61053.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61054.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA61055.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA61056.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA61057.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61058.1| hypothetical protein, partial [Erythranthe nasuta] Length = 113 Score = 63.5 bits (153), Expect = 1e-09 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 M+++D SKY HSPVHKA+I KDY+GLR++++ LPRL DP Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDP 39 >gb|AGA60918.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60920.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60928.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60930.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60932.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60938.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60940.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60950.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60952.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60954.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60956.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60974.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60978.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60980.1| hypothetical protein, partial [Mimulus sookensis] Length = 113 Score = 63.5 bits (153), Expect = 1e-09 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 M+++D SKY HSPVHKA+I KDY+GLR++++ LPRL DP Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDP 39 >ref|XP_008804748.1| PREDICTED: ankyrin repeat domain-containing protein 13C [Phoenix dactylifera] Length = 647 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/39 (71%), Positives = 38/39 (97%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA IDA+KY+HSPVH+AV+A+DY+GL+R+L++LPRLADP Sbjct: 1 MAGIDAAKYAHSPVHRAVLARDYAGLKRILAALPRLADP 39 >ref|XP_010522417.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Tarenaya hassleriana] Length = 656 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA ID SKY HSPVHKAV+ +DY+GLRR+LS+LPRL+DP Sbjct: 1 MATIDVSKYLHSPVHKAVVLRDYAGLRRILSALPRLSDP 39 >ref|XP_020673000.1| ankyrin repeat domain-containing protein 13C [Dendrobium catenatum] gb|PKU83197.1| hypothetical protein MA16_Dca006597 [Dendrobium catenatum] Length = 660 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA ID KY+HSPVHKAV+A+DYSGL+R+L+SLPRL DP Sbjct: 1 MAGIDPLKYAHSPVHKAVLARDYSGLKRILASLPRLLDP 39 >ref|XP_008796417.1| PREDICTED: ankyrin repeat domain-containing protein 13C [Phoenix dactylifera] Length = 660 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA IDASKYSHSPVHKAV+A+DY L+ ++SSLPRLA+P Sbjct: 1 MAGIDASKYSHSPVHKAVLARDYEALKTIISSLPRLAEP 39 >ref|XP_009396014.1| PREDICTED: ankyrin repeat domain-containing protein 13C-A-like [Musa acuminata subsp. malaccensis] Length = 621 Score = 65.5 bits (158), Expect = 5e-09 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA +D SKY+HSP HKAV+A+DY+GL+RVL++LPRLADP Sbjct: 1 MAGMDPSKYAHSPAHKAVLARDYAGLKRVLAALPRLADP 39 >emb|CDO99416.1| unnamed protein product [Coffea canephora] Length = 635 Score = 65.1 bits (157), Expect = 7e-09 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA+ID KY+HSPVHKA+I KDY+GLRR+++ LPRL DP Sbjct: 1 MASIDVGKYAHSPVHKAIILKDYAGLRRIIAGLPRLCDP 39 >ref|XP_023736408.1| ankyrin repeat domain-containing protein 13C-A-like [Lactuca sativa] ref|XP_023736409.1| ankyrin repeat domain-containing protein 13C-A-like [Lactuca sativa] gb|PLY71789.1| hypothetical protein LSAT_6X61621 [Lactuca sativa] Length = 671 Score = 65.1 bits (157), Expect = 7e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MAAID +KYSHSP HKAV+ KDY GLR++++ LPRL DP Sbjct: 1 MAAIDVTKYSHSPTHKAVVTKDYGGLRKIIAGLPRLCDP 39 >ref|XP_022873734.1| uncharacterized protein LOC111392607 [Olea europaea var. sylvestris] ref|XP_022873735.1| uncharacterized protein LOC111392607 [Olea europaea var. sylvestris] Length = 650 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MA +D SKY HSPVHKA+I KDY+ LRR+++SLPRL DP Sbjct: 1 MAGVDVSKYGHSPVHKAIILKDYAALRRIIASLPRLCDP 39 >ref|XP_011091404.1| uncharacterized protein LOC105171856 [Sesamum indicum] ref|XP_011091405.1| uncharacterized protein LOC105171856 [Sesamum indicum] Length = 649 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 M+++D SKY HSPVHK +I KDY+GLRR+L+ LPRL DP Sbjct: 1 MSSVDVSKYEHSPVHKTIILKDYAGLRRILAGLPRLCDP 39 >ref|XP_012844185.1| PREDICTED: uncharacterized protein LOC105964204 [Erythranthe guttata] ref|XP_012844186.1| PREDICTED: uncharacterized protein LOC105964204 [Erythranthe guttata] ref|XP_012844187.1| PREDICTED: uncharacterized protein LOC105964204 [Erythranthe guttata] gb|EYU31733.1| hypothetical protein MIMGU_mgv1a002666mg [Erythranthe guttata] Length = 648 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 M+++D SKY HSPVHKA+I KDY+GLR++++ LPRL DP Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDP 39 >dbj|GAV67556.1| GPCR_chapero_1 domain-containing protein/Ank_2 domain-containing protein [Cephalotus follicularis] Length = 649 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +2 Query: 386 MAAIDASKYSHSPVHKAVIAKDYSGLRRVLSSLPRLADP 502 MAA+D SKY+HSPVHKA+ KDY+GLRR+++ LPRL +P Sbjct: 1 MAAVDLSKYAHSPVHKAIATKDYAGLRRIIAGLPRLCNP 39