BLASTX nr result
ID: Ophiopogon23_contig00026968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00026968 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267836.1| PREDICTED: uncharacterized protein LOC104604... 57 2e-06 gb|PIA50848.1| hypothetical protein AQUCO_01200252v1 [Aquilegia ... 55 8e-06 >ref|XP_010267836.1| PREDICTED: uncharacterized protein LOC104604952 [Nelumbo nucifera] Length = 623 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +1 Query: 1 RSVPGRVQVPFSRLTDTRDFYSGPNP-RQINGY 96 R +PGR QVPFSRLTDTR+FYSGP P RQINGY Sbjct: 591 RGLPGRNQVPFSRLTDTREFYSGPTPRRQINGY 623 >gb|PIA50848.1| hypothetical protein AQUCO_01200252v1 [Aquilegia coerulea] gb|PIA50850.1| hypothetical protein AQUCO_01200252v1 [Aquilegia coerulea] Length = 668 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +1 Query: 1 RSVPGRVQVPFSRLTDTRDFYSGPNP-RQINGY 96 R +PGR Q+PFSRLT+TR+FYSGP P RQINGY Sbjct: 636 RGLPGRNQIPFSRLTETREFYSGPTPRRQINGY 668