BLASTX nr result
ID: Ophiopogon23_contig00026883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00026883 (573 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009382596.2| PREDICTED: thioredoxin reductase NTRC [Musa ... 78 2e-13 ref|XP_020108409.1| thioredoxin reductase NTRC [Ananas comosus] 76 1e-12 ref|XP_010279496.1| PREDICTED: thioredoxin reductase NTRC [Nelum... 76 1e-12 gb|ESR34560.1| hypothetical protein CICLE_v10004686mg [Citrus cl... 75 2e-12 dbj|GAY65298.1| hypothetical protein CUMW_240010 [Citrus unshiu]... 75 2e-12 ref|XP_006492934.1| PREDICTED: thioredoxin reductase NTRC [Citru... 75 2e-12 ref|XP_006421319.1| thioredoxin reductase NTRC [Citrus clementin... 75 2e-12 ref|XP_020519377.1| thioredoxin reductase NTRC isoform X3 [Ambor... 75 2e-12 ref|XP_010938542.1| PREDICTED: thioredoxin reductase NTRC [Elaei... 75 2e-12 gb|KDO48195.1| hypothetical protein CISIN_1g0092242mg, partial [... 74 2e-12 ref|XP_006837423.1| thioredoxin reductase NTRC isoform X2 [Ambor... 75 2e-12 ref|XP_020519376.1| thioredoxin reductase NTRC isoform X1 [Ambor... 75 2e-12 ref|XP_010523800.1| PREDICTED: NADPH-dependent thioredoxin reduc... 74 4e-12 ref|XP_010105216.1| thioredoxin reductase NTRC [Morus notabilis]... 74 4e-12 ref|XP_010554821.1| PREDICTED: NADPH-dependent thioredoxin reduc... 74 4e-12 ref|XP_010554820.1| PREDICTED: NADPH-dependent thioredoxin reduc... 74 4e-12 gb|PON86892.1| Thioredoxin reductase [Trema orientalis] 74 6e-12 ref|XP_021898022.1| NADPH-dependent thioredoxin reductase 3 [Car... 74 6e-12 ref|XP_008782037.1| PREDICTED: thioredoxin reductase NTRC [Phoen... 74 6e-12 gb|KJB19247.1| hypothetical protein B456_003G091100 [Gossypium r... 74 6e-12 >ref|XP_009382596.2| PREDICTED: thioredoxin reductase NTRC [Musa acuminata subsp. malaccensis] Length = 566 Score = 78.2 bits (191), Expect = 2e-13 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 150 HVAIAVPVPHRVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 H+ + + RVFNNPNVTVHFNTEA+DVVSNSKGQMSG+L +RVDTGE+ Sbjct: 300 HLRASKAMQDRVFNNPNVTVHFNTEAMDVVSNSKGQMSGVLTKRVDTGEE 349 >ref|XP_020108409.1| thioredoxin reductase NTRC [Ananas comosus] Length = 532 Score = 76.3 bits (186), Expect = 1e-12 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = -1 Query: 150 HVAIAVPVPHRVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 H+ + + RV NNPN+TVHFNTEA+DVVSN+KGQMSG+LL+RVDTGE+ Sbjct: 265 HLRASKAMQDRVLNNPNITVHFNTEAMDVVSNTKGQMSGVLLKRVDTGEE 314 >ref|XP_010279496.1| PREDICTED: thioredoxin reductase NTRC [Nelumbo nucifera] Length = 526 Score = 75.9 bits (185), Expect = 1e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+T+HFNTEAVDVVSNSKGQMSGILL +VDTG++ Sbjct: 270 RVFNNPNITLHFNTEAVDVVSNSKGQMSGILLRKVDTGDE 309 >gb|ESR34560.1| hypothetical protein CICLE_v10004686mg [Citrus clementina] Length = 529 Score = 75.5 bits (184), Expect = 2e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN+KGQMSGILL +VDTGE+ Sbjct: 288 RVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEE 327 >dbj|GAY65298.1| hypothetical protein CUMW_240010 [Citrus unshiu] dbj|GAY65299.1| hypothetical protein CUMW_240010 [Citrus unshiu] Length = 540 Score = 75.5 bits (184), Expect = 2e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN+KGQMSGILL +VDTGE+ Sbjct: 284 RVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEE 323 >ref|XP_006492934.1| PREDICTED: thioredoxin reductase NTRC [Citrus sinensis] ref|XP_006492935.1| PREDICTED: thioredoxin reductase NTRC [Citrus sinensis] Length = 544 Score = 75.5 bits (184), Expect = 2e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN+KGQMSGILL +VDTGE+ Sbjct: 288 RVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEE 327 >ref|XP_006421319.1| thioredoxin reductase NTRC [Citrus clementina] ref|XP_024037595.1| thioredoxin reductase NTRC [Citrus clementina] ref|XP_024037600.1| thioredoxin reductase NTRC [Citrus clementina] gb|ESR34559.1| hypothetical protein CICLE_v10004686mg [Citrus clementina] Length = 544 Score = 75.5 bits (184), Expect = 2e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN+KGQMSGILL +VDTGE+ Sbjct: 288 RVFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEE 327 >ref|XP_020519377.1| thioredoxin reductase NTRC isoform X3 [Amborella trichopoda] Length = 509 Score = 75.1 bits (183), Expect = 2e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -1 Query: 150 HVAIAVPVPHRVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 H+ + + R++NNPN+ +HFNTEAVDVVSNSKGQMSGILL++ DTGEQ Sbjct: 304 HLRASKAMQDRIYNNPNIALHFNTEAVDVVSNSKGQMSGILLKKTDTGEQ 353 >ref|XP_010938542.1| PREDICTED: thioredoxin reductase NTRC [Elaeis guineensis] Length = 527 Score = 75.1 bits (183), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGE 4 RVFNNPN+TVHFNTEAVD VSN+KGQMSGIL++RVDTGE Sbjct: 271 RVFNNPNITVHFNTEAVDAVSNNKGQMSGILVKRVDTGE 309 >gb|KDO48195.1| hypothetical protein CISIN_1g0092242mg, partial [Citrus sinensis] Length = 256 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 117 VFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 VFNNPN+TVHFNTE VDVVSN+KGQMSGILL +VDTGE+ Sbjct: 1 VFNNPNITVHFNTETVDVVSNTKGQMSGILLRKVDTGEE 39 >ref|XP_006837423.1| thioredoxin reductase NTRC isoform X2 [Amborella trichopoda] gb|ERN00277.1| hypothetical protein AMTR_s00107p00020160 [Amborella trichopoda] Length = 564 Score = 75.1 bits (183), Expect = 2e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -1 Query: 150 HVAIAVPVPHRVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 H+ + + R++NNPN+ +HFNTEAVDVVSNSKGQMSGILL++ DTGEQ Sbjct: 298 HLRASKAMQDRIYNNPNIALHFNTEAVDVVSNSKGQMSGILLKKTDTGEQ 347 >ref|XP_020519376.1| thioredoxin reductase NTRC isoform X1 [Amborella trichopoda] Length = 570 Score = 75.1 bits (183), Expect = 2e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -1 Query: 150 HVAIAVPVPHRVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 H+ + + R++NNPN+ +HFNTEAVDVVSNSKGQMSGILL++ DTGEQ Sbjct: 304 HLRASKAMQDRIYNNPNIALHFNTEAVDVVSNSKGQMSGILLKKTDTGEQ 353 >ref|XP_010523800.1| PREDICTED: NADPH-dependent thioredoxin reductase 3 [Tarenaya hassleriana] Length = 508 Score = 74.3 bits (181), Expect = 4e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN++GQMSGIL+ RVDTGE+ Sbjct: 252 RVFNNPNITVHFNTETVDVVSNTRGQMSGILVRRVDTGEE 291 >ref|XP_010105216.1| thioredoxin reductase NTRC [Morus notabilis] gb|EXC04081.1| NADPH-dependent thioredoxin reductase 3 [Morus notabilis] Length = 519 Score = 74.3 bits (181), Expect = 4e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVH+NTE VDVVSN+KGQMSGILL +VDTGE+ Sbjct: 263 RVFNNPNITVHYNTETVDVVSNTKGQMSGILLRKVDTGEE 302 >ref|XP_010554821.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like isoform X2 [Tarenaya hassleriana] Length = 520 Score = 74.3 bits (181), Expect = 4e-12 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN++GQMSG+L+ RVDTGE+ Sbjct: 264 RVFNNPNITVHFNTETVDVVSNTRGQMSGVLIRRVDTGEE 303 >ref|XP_010554820.1| PREDICTED: NADPH-dependent thioredoxin reductase 3-like isoform X1 [Tarenaya hassleriana] Length = 521 Score = 74.3 bits (181), Expect = 4e-12 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE VDVVSN++GQMSG+L+ RVDTGE+ Sbjct: 264 RVFNNPNITVHFNTETVDVVSNTRGQMSGVLIRRVDTGEE 303 >gb|PON86892.1| Thioredoxin reductase [Trema orientalis] Length = 519 Score = 73.9 bits (180), Expect = 6e-12 Identities = 32/40 (80%), Positives = 39/40 (97%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPN+TVHFNTE +DVVSN+KGQMSGIL+++VDTGE+ Sbjct: 263 RVFNNPNITVHFNTETMDVVSNTKGQMSGILVQKVDTGEE 302 >ref|XP_021898022.1| NADPH-dependent thioredoxin reductase 3 [Carica papaya] Length = 526 Score = 73.9 bits (180), Expect = 6e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RVFNNPNVTVHFNTEAVDV+SN+KGQMSGIL+ +V TGE+ Sbjct: 270 RVFNNPNVTVHFNTEAVDVISNTKGQMSGILIRKVSTGEE 309 >ref|XP_008782037.1| PREDICTED: thioredoxin reductase NTRC [Phoenix dactylifera] Length = 527 Score = 73.9 bits (180), Expect = 6e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGE 4 RVFNNPN+TVHFNTEA+D VSN+KGQMSGIL++RVDTGE Sbjct: 271 RVFNNPNITVHFNTEAMDAVSNNKGQMSGILVKRVDTGE 309 >gb|KJB19247.1| hypothetical protein B456_003G091100 [Gossypium raimondii] Length = 380 Score = 73.6 bits (179), Expect = 6e-12 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -1 Query: 120 RVFNNPNVTVHFNTEAVDVVSNSKGQMSGILLERVDTGEQ 1 RV+NNPN+T+HFNTEAVDVVSN+KGQMSGIL R+DTGE+ Sbjct: 124 RVYNNPNITLHFNTEAVDVVSNTKGQMSGILTRRIDTGEE 163