BLASTX nr result
ID: Ophiopogon23_contig00026630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00026630 (503 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55318.1| uncharacterized protein A4U43_UnF5030 [Asparagus ... 59 2e-08 gb|PLY83266.1| hypothetical protein LSAT_4X89240 [Lactuca sativa] 54 3e-06 ref|XP_010936431.1| PREDICTED: uncharacterized protein LOC105056... 54 9e-06 >gb|ONK55318.1| uncharacterized protein A4U43_UnF5030 [Asparagus officinalis] Length = 84 Score = 58.5 bits (140), Expect = 2e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 184 GKMMKAPGRDGERIPRDKFEENPKGYFKDLRGKGK*IECS 303 GKMMKAPGR+GE +PRD+FE + + YF+DLRGKG CS Sbjct: 43 GKMMKAPGRNGELMPRDEFEGDTRTYFRDLRGKGNFCVCS 82 >gb|PLY83266.1| hypothetical protein LSAT_4X89240 [Lactuca sativa] Length = 99 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 166 EDDRAGGKMMKAPGRDGERIPRDKFEENPKGYFKDLRGK 282 + ++ KMMKAPGR +PRDKFE+NPK YF DLRGK Sbjct: 61 DSQKSAAKMMKAPGRS-TMMPRDKFEDNPKAYFSDLRGK 98 >ref|XP_010936431.1| PREDICTED: uncharacterized protein LOC105056065 [Elaeis guineensis] Length = 181 Score = 53.9 bits (128), Expect = 9e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 175 RAGGKMMKAPGRDGERIPRDKFEENPKGYFKDLR 276 RA GKMMKAPG G R+PR FE NP+GYF++LR Sbjct: 145 RAAGKMMKAPGSGGRRMPRASFESNPRGYFQNLR 178