BLASTX nr result
ID: Ophiopogon23_contig00026340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00026340 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFB49719.1| hypothetical protein ZHAS_00018371 [Anopheles sin... 56 2e-06 >gb|KFB49719.1| hypothetical protein ZHAS_00018371 [Anopheles sinensis] Length = 715 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -1 Query: 191 CVPYYECVEDSETSIDGTHIIDNR-DEDPSEGPWCPHYLDKCC 66 CVPYY C +D+ DGT+IID R EDP GP CPHYLD CC Sbjct: 366 CVPYYMC-KDNLVIEDGTNIIDIRVGEDPEAGPECPHYLDVCC 407