BLASTX nr result
ID: Ophiopogon23_contig00025625
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00025625 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273884.1| LOW QUALITY PROTEIN: receptor-like protein k... 72 4e-12 >ref|XP_020273884.1| LOW QUALITY PROTEIN: receptor-like protein kinase HERK 1 [Asparagus officinalis] Length = 841 Score = 72.0 bits (175), Expect = 4e-12 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 275 MGIKNHELCFVFLPILCLICSCNAFVPADNYLIDCG 382 MG+KNHEL FVFLPI CLIC+C+AF PADNYLIDCG Sbjct: 1 MGVKNHELGFVFLPIACLICACDAFTPADNYLIDCG 36