BLASTX nr result
ID: Ophiopogon23_contig00025009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00025009 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011495657.1| PREDICTED: serine/threonine-protein kinase D... 81 4e-15 ref|XP_017796332.1| PREDICTED: serine/threonine-protein kinase D... 72 8e-15 ref|XP_011495655.1| PREDICTED: dual specificity protein kinase C... 80 1e-14 gb|KOC59480.1| Serine/threonine-protein kinase Doa, partial [Hab... 71 2e-14 ref|XP_012283057.1| dual specificity protein kinase CLK2 isoform... 79 2e-14 ref|XP_012283056.1| dual specificity protein kinase CLK2 isoform... 79 2e-14 ref|XP_012283055.1| dual specificity protein kinase CLK2 isoform... 79 2e-14 ref|XP_012283054.1| dual specificity protein kinase CLK2 isoform... 79 2e-14 ref|XP_017762021.1| PREDICTED: serine/threonine-protein kinase D... 69 5e-14 ref|XP_017762018.1| PREDICTED: serine/threonine-protein kinase D... 69 5e-14 gb|EFZ18607.1| hypothetical protein SINV_02130, partial [Solenop... 72 8e-14 ref|XP_017762019.1| PREDICTED: serine/threonine-protein kinase D... 68 1e-13 gb|OAD53958.1| Serine/threonine-protein kinase Doa, partial [Euf... 68 1e-13 ref|XP_011495656.1| PREDICTED: serine/threonine-protein kinase D... 77 1e-13 ref|XP_014236572.1| serine/threonine-protein kinase Doa isoform ... 74 1e-12 ref|XP_014236570.1| dual specificity protein kinase CLK2 isoform... 74 1e-12 ref|XP_014236565.1| dual specificity protein kinase CLK2 isoform... 74 1e-12 ref|XP_014236567.1| dual specificity protein kinase CLK2 isoform... 74 1e-12 ref|XP_014236568.1| dual specificity protein kinase CLK2 isoform... 74 1e-12 ref|XP_014236566.1| dual specificity protein kinase CLK2 isoform... 74 1e-12 >ref|XP_011495657.1| PREDICTED: serine/threonine-protein kinase Doa isoform X3 [Ceratosolen solmsi marchali] Length = 536 Score = 81.3 bits (199), Expect = 4e-15 Identities = 47/101 (46%), Positives = 59/101 (58%), Gaps = 5/101 (4%) Frame = -2 Query: 406 VLVFSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQ-----LKHSHAQRTEQRDREKVX 242 VL+ SGERVLR HERG+SQERRYKRSHRRSPSSG+ ++H+H +R RDR++ Sbjct: 6 VLLSSGERVLRLRQHERGTSQERRYKRSHRRSPSSGRQHSHAVQHAHRERDRDRDRDR-- 63 Query: 241 XXXXXXXXXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHSS 119 +SS+KRNR RRHH+S Sbjct: 64 ------ERDRERDRPAASGLAGSTSAMSSSKRNRGRRHHAS 98 >ref|XP_017796332.1| PREDICTED: serine/threonine-protein kinase Doa isoform X3 [Habropoda laboriosa] Length = 507 Score = 72.0 bits (175), Expect(2) = 8e-15 Identities = 44/99 (44%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXX 218 +SGERVLRS H+RG+SQERRYKRSHRRSP+SG+ +H H RDR+++ Sbjct: 55 YSGERVLRSRQHDRGTSQERRYKRSHRRSPTSGRQQHGH----RDRDRDRLAHP------ 104 Query: 217 XXXXXXXXXXXXXXXHRQISSAKRNRQRRHH-SSSAEQD 104 +S++R R RHH SSSA QD Sbjct: 105 -------------------TSSRRARIYRHHASSSASQD 124 Score = 35.8 bits (81), Expect(2) = 8e-15 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 53 KILATLGEGTFGKVVKV 3 K+LATLGEGTFGKVVKV Sbjct: 164 KVLATLGEGTFGKVVKV 180 >ref|XP_011495655.1| PREDICTED: dual specificity protein kinase CLK3 isoform X1 [Ceratosolen solmsi marchali] Length = 656 Score = 79.7 bits (195), Expect = 1e-14 Identities = 45/98 (45%), Positives = 57/98 (58%), Gaps = 5/98 (5%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQ-----LKHSHAQRTEQRDREKVXXXX 233 +SGERVLR HERG+SQERRYKRSHRRSPSSG+ ++H+H +R RDR++ Sbjct: 129 YSGERVLRLRQHERGTSQERRYKRSHRRSPSSGRQHSHAVQHAHRERDRDRDRDR----- 183 Query: 232 XXXXXXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHSS 119 +SS+KRNR RRHH+S Sbjct: 184 ---ERDRERDRPAASGLAGSTSAMSSSKRNRGRRHHAS 218 >gb|KOC59480.1| Serine/threonine-protein kinase Doa, partial [Habropoda laboriosa] Length = 452 Score = 70.9 bits (172), Expect(2) = 2e-14 Identities = 44/98 (44%), Positives = 55/98 (56%), Gaps = 1/98 (1%) Frame = -2 Query: 394 SGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXXX 215 SGERVLRS H+RG+SQERRYKRSHRRSP+SG+ +H H RDR+++ Sbjct: 1 SGERVLRSRQHDRGTSQERRYKRSHRRSPTSGRQQHGH----RDRDRDRLAHP------- 49 Query: 214 XXXXXXXXXXXXXXHRQISSAKRNRQRRHH-SSSAEQD 104 +S++R R RHH SSSA QD Sbjct: 50 ------------------TSSRRARIYRHHASSSASQD 69 Score = 35.8 bits (81), Expect(2) = 2e-14 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 53 KILATLGEGTFGKVVKV 3 K+LATLGEGTFGKVVKV Sbjct: 109 KVLATLGEGTFGKVVKV 125 >ref|XP_012283057.1| dual specificity protein kinase CLK2 isoform X5 [Orussus abietinus] ref|XP_012283058.1| dual specificity protein kinase CLK2 isoform X5 [Orussus abietinus] Length = 534 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 403 LVFSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREK 248 L+ SGERVLRS HERG+SQERRYKRSHRRSPSSG+ +HSHA R +RDRE+ Sbjct: 57 LLSSGERVLRSRQHERGTSQERRYKRSHRRSPSSGR-QHSHAHRDRERDRER 107 >ref|XP_012283056.1| dual specificity protein kinase CLK2 isoform X4 [Orussus abietinus] Length = 558 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 403 LVFSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREK 248 L+ SGERVLRS HERG+SQERRYKRSHRRSPSSG+ +HSHA R +RDRE+ Sbjct: 81 LLSSGERVLRSRQHERGTSQERRYKRSHRRSPSSGR-QHSHAHRDRERDRER 131 >ref|XP_012283055.1| dual specificity protein kinase CLK2 isoform X3 [Orussus abietinus] Length = 558 Score = 79.3 bits (194), Expect = 2e-14 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREK 248 +SGERVLRS HERG+SQERRYKRSHRRSPSSG+ +HSHA R +RDRE+ Sbjct: 83 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSGR-QHSHAHRDRERDRER 131 >ref|XP_012283054.1| dual specificity protein kinase CLK2 isoform X2 [Orussus abietinus] Length = 573 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 403 LVFSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREK 248 L+ SGERVLRS HERG+SQERRYKRSHRRSPSSG+ +HSHA R +RDRE+ Sbjct: 96 LLSSGERVLRSRQHERGTSQERRYKRSHRRSPSSGR-QHSHAHRDRERDRER 146 >ref|XP_017762021.1| PREDICTED: serine/threonine-protein kinase Doa isoform X4 [Eufriesea mexicana] Length = 520 Score = 69.3 bits (168), Expect(2) = 5e-14 Identities = 45/99 (45%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXX 218 +SGERVLRS H+RG+SQERRYKRSHRRSPSSG+ +H H RDR+++ Sbjct: 69 YSGERVLRSRQHDRGTSQERRYKRSHRRSPSSGR-QHGH----RDRDRDRLAHP------ 117 Query: 217 XXXXXXXXXXXXXXXHRQISSAKRNRQRRHH-SSSAEQD 104 +S++R R RHH SSSA QD Sbjct: 118 -------------------TSSRRARIYRHHASSSASQD 137 Score = 35.8 bits (81), Expect(2) = 5e-14 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 53 KILATLGEGTFGKVVKV 3 K+LATLGEGTFGKVVKV Sbjct: 177 KVLATLGEGTFGKVVKV 193 >ref|XP_017762018.1| PREDICTED: serine/threonine-protein kinase Doa isoform X1 [Eufriesea mexicana] Length = 495 Score = 69.3 bits (168), Expect(2) = 5e-14 Identities = 45/99 (45%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXX 218 +SGERVLRS H+RG+SQERRYKRSHRRSPSSG+ +H H RDR+++ Sbjct: 44 YSGERVLRSRQHDRGTSQERRYKRSHRRSPSSGR-QHGH----RDRDRDRLAHP------ 92 Query: 217 XXXXXXXXXXXXXXXHRQISSAKRNRQRRHH-SSSAEQD 104 +S++R R RHH SSSA QD Sbjct: 93 -------------------TSSRRARIYRHHASSSASQD 112 Score = 35.8 bits (81), Expect(2) = 5e-14 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 53 KILATLGEGTFGKVVKV 3 K+LATLGEGTFGKVVKV Sbjct: 152 KVLATLGEGTFGKVVKV 168 >gb|EFZ18607.1| hypothetical protein SINV_02130, partial [Solenopsis invicta] Length = 93 Score = 72.0 bits (175), Expect = 8e-14 Identities = 43/95 (45%), Positives = 50/95 (52%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXX 218 FSGERVLRS HERG+SQERRYKRSHRRSPSSG+ H R RDR + Sbjct: 11 FSGERVLRSRQHERGTSQERRYKRSHRRSPSSGR---QHGHRDRDRDRAHLAHP------ 61 Query: 217 XXXXXXXXXXXXXXXHRQISSAKRNRQRRHHSSSA 113 +S++R R RHH SS+ Sbjct: 62 -------------------TSSRRTRLHRHHGSSS 77 >ref|XP_017762019.1| PREDICTED: serine/threonine-protein kinase Doa isoform X2 [Eufriesea mexicana] Length = 464 Score = 68.2 bits (165), Expect(2) = 1e-13 Identities = 45/98 (45%), Positives = 55/98 (56%), Gaps = 1/98 (1%) Frame = -2 Query: 394 SGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXXX 215 SGERVLRS H+RG+SQERRYKRSHRRSPSSG+ +H H RDR+++ Sbjct: 14 SGERVLRSRQHDRGTSQERRYKRSHRRSPSSGR-QHGH----RDRDRDRLAHP------- 61 Query: 214 XXXXXXXXXXXXXXHRQISSAKRNRQRRHH-SSSAEQD 104 +S++R R RHH SSSA QD Sbjct: 62 ------------------TSSRRARIYRHHASSSASQD 81 Score = 35.8 bits (81), Expect(2) = 1e-13 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 53 KILATLGEGTFGKVVKV 3 K+LATLGEGTFGKVVKV Sbjct: 121 KVLATLGEGTFGKVVKV 137 >gb|OAD53958.1| Serine/threonine-protein kinase Doa, partial [Eufriesea mexicana] Length = 451 Score = 68.2 bits (165), Expect(2) = 1e-13 Identities = 45/98 (45%), Positives = 55/98 (56%), Gaps = 1/98 (1%) Frame = -2 Query: 394 SGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSHAQRTEQRDREKVXXXXXXXXXX 215 SGERVLRS H+RG+SQERRYKRSHRRSPSSG+ +H H RDR+++ Sbjct: 1 SGERVLRSRQHDRGTSQERRYKRSHRRSPSSGR-QHGH----RDRDRDRLAHP------- 48 Query: 214 XXXXXXXXXXXXXXHRQISSAKRNRQRRHH-SSSAEQD 104 +S++R R RHH SSSA QD Sbjct: 49 ------------------TSSRRARIYRHHASSSASQD 68 Score = 35.8 bits (81), Expect(2) = 1e-13 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 53 KILATLGEGTFGKVVKV 3 K+LATLGEGTFGKVVKV Sbjct: 108 KVLATLGEGTFGKVVKV 124 >ref|XP_011495656.1| PREDICTED: serine/threonine-protein kinase Doa isoform X2 [Ceratosolen solmsi marchali] Length = 573 Score = 77.0 bits (188), Expect = 1e-13 Identities = 44/96 (45%), Positives = 55/96 (57%), Gaps = 5/96 (5%) Frame = -2 Query: 391 GERVLRSGHHERGSSQERRYKRSHRRSPSSGQ-----LKHSHAQRTEQRDREKVXXXXXX 227 GERVLR HERG+SQERRYKRSHRRSPSSG+ ++H+H +R RDR++ Sbjct: 48 GERVLRLRQHERGTSQERRYKRSHRRSPSSGRQHSHAVQHAHRERDRDRDRDR------- 100 Query: 226 XXXXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHSS 119 +SS+KRNR RRHH+S Sbjct: 101 -ERDRERDRPAASGLAGSTSAMSSSKRNRGRRHHAS 135 >ref|XP_014236572.1| serine/threonine-protein kinase Doa isoform X8 [Trichogramma pretiosum] ref|XP_014236573.1| serine/threonine-protein kinase Doa isoform X8 [Trichogramma pretiosum] ref|XP_014236574.1| serine/threonine-protein kinase Doa isoform X8 [Trichogramma pretiosum] Length = 535 Score = 73.9 bits (180), Expect = 1e-12 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSH-AQRTEQRDREKVXXXXXXXX 221 +SGERVLRS HERG+SQERRYKRSHRRSPSS Q HSH AQ +RDR++ Sbjct: 40 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSRQ--HSHAAQHHRERDRDR--------- 88 Query: 220 XXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHS 122 SS+KRN + RHH+ Sbjct: 89 --PKEATLNSHHQVSMSSSSSSSKRNHRHRHHA 119 >ref|XP_014236570.1| dual specificity protein kinase CLK2 isoform X7 [Trichogramma pretiosum] Length = 572 Score = 73.9 bits (180), Expect = 1e-12 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSH-AQRTEQRDREKVXXXXXXXX 221 +SGERVLRS HERG+SQERRYKRSHRRSPSS Q HSH AQ +RDR++ Sbjct: 77 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSRQ--HSHAAQHHRERDRDR--------- 125 Query: 220 XXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHS 122 SS+KRN + RHH+ Sbjct: 126 --PKEATLNSHHQVSMSSSSSSSKRNHRHRHHA 156 >ref|XP_014236565.1| dual specificity protein kinase CLK2 isoform X3 [Trichogramma pretiosum] Length = 580 Score = 73.9 bits (180), Expect = 1e-12 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSH-AQRTEQRDREKVXXXXXXXX 221 +SGERVLRS HERG+SQERRYKRSHRRSPSS Q HSH AQ +RDR++ Sbjct: 85 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSRQ--HSHAAQHHRERDRDR--------- 133 Query: 220 XXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHS 122 SS+KRN + RHH+ Sbjct: 134 --PKEATLNSHHQVSMSSSSSSSKRNHRHRHHA 164 >ref|XP_014236567.1| dual specificity protein kinase CLK2 isoform X4 [Trichogramma pretiosum] Length = 584 Score = 73.9 bits (180), Expect = 1e-12 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSH-AQRTEQRDREKVXXXXXXXX 221 +SGERVLRS HERG+SQERRYKRSHRRSPSS Q HSH AQ +RDR++ Sbjct: 89 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSRQ--HSHAAQHHRERDRDR--------- 137 Query: 220 XXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHS 122 SS+KRN + RHH+ Sbjct: 138 --PKEATLNSHHQVSMSSSSSSSKRNHRHRHHA 168 >ref|XP_014236568.1| dual specificity protein kinase CLK2 isoform X5 [Trichogramma pretiosum] Length = 588 Score = 73.9 bits (180), Expect = 1e-12 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSH-AQRTEQRDREKVXXXXXXXX 221 +SGERVLRS HERG+SQERRYKRSHRRSPSS Q HSH AQ +RDR++ Sbjct: 93 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSRQ--HSHAAQHHRERDRDR--------- 141 Query: 220 XXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHS 122 SS+KRN + RHH+ Sbjct: 142 --PKEATLNSHHQVSMSSSSSSSKRNHRHRHHA 172 >ref|XP_014236566.1| dual specificity protein kinase CLK2 isoform X2 [Trichogramma pretiosum] Length = 640 Score = 73.9 bits (180), Expect = 1e-12 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = -2 Query: 397 FSGERVLRSGHHERGSSQERRYKRSHRRSPSSGQLKHSH-AQRTEQRDREKVXXXXXXXX 221 +SGERVLRS HERG+SQERRYKRSHRRSPSS Q HSH AQ +RDR++ Sbjct: 145 YSGERVLRSRQHERGTSQERRYKRSHRRSPSSRQ--HSHAAQHHRERDRDR--------- 193 Query: 220 XXXXXXXXXXXXXXXXHRQISSAKRNRQRRHHS 122 SS+KRN + RHH+ Sbjct: 194 --PKEATLNSHHQVSMSSSSSSSKRNHRHRHHA 224