BLASTX nr result
ID: Ophiopogon23_contig00024971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024971 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008344385.1| PREDICTED: transducin beta-like protein 2 [M... 57 9e-07 gb|KQK86084.1| hypothetical protein SETIT_035701mg [Setaria ital... 57 1e-06 >ref|XP_008344385.1| PREDICTED: transducin beta-like protein 2 [Malus domestica] Length = 385 Score = 57.4 bits (137), Expect = 9e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +2 Query: 26 KSAVASLCFSQNSEQIMTASRDDSLRIWNINGML--YGVACI 145 KSAV LCF+ NSEQ++TAS+D S+RIWNINGM Y V CI Sbjct: 298 KSAVTWLCFTPNSEQMITASKDGSIRIWNINGMYDWYSVLCI 339 >gb|KQK86084.1| hypothetical protein SETIT_035701mg [Setaria italica] Length = 344 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 2 VQLLLHVLKSAVASLCFSQNSEQIMTASRDDSLRIWNINGM 124 +QL+ H KSAV SLCF+ NSEQI+TAS+D S+R+WNING+ Sbjct: 298 MQLMGH--KSAVTSLCFAPNSEQIITASKDGSIRVWNINGI 336