BLASTX nr result
ID: Ophiopogon23_contig00024899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024899 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_077389604.1| hypothetical protein [Mobilibacterium timone... 56 1e-06 gb|PSK45173.1| Ribonuclease H1 [Elsinoe australis] 56 2e-06 ref|WP_088653478.1| ribonuclease H [Geofilum rhodophaeum] 55 3e-06 ref|WP_068456654.1| hypothetical protein [Peptoniphilus sp. KHD5] 54 1e-05 >ref|WP_077389604.1| hypothetical protein [Mobilibacterium timonense] Length = 226 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 211 RAIYVVFVGRRPGLYYDWNECAAQVTGYKKALFKRFSTQ 327 + +Y V VGR+PGLYYDWN C QVTG+ A FK F+T+ Sbjct: 3 KKVYAVRVGRKPGLYYDWNNCKKQVTGFPGAEFKGFATE 41 >gb|PSK45173.1| Ribonuclease H1 [Elsinoe australis] Length = 399 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +1 Query: 199 QGGMRAIYVVFVGRRPGLYYDWNECAAQVTGYKKALFKRFSTQR 330 +G Y V G +PG+Y+DWN+C AQ+TG+K A+FK F TQ+ Sbjct: 15 RGSEPKFYAVHRGAKPGIYHDWNDCRAQITGFKGAIFKSFPTQQ 58 >ref|WP_088653478.1| ribonuclease H [Geofilum rhodophaeum] Length = 209 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/67 (43%), Positives = 40/67 (59%) Frame = +1 Query: 211 RAIYVVFVGRRPGLYYDWNECAAQVTGYKKALFKRFSTQRRQRRLSWNTGGPVIPTRKFD 390 +A YVV+ GR+PG+Y W EC AQV G +K+ FK+F T + R ++ G P RK Sbjct: 3 KAYYVVWSGRQPGIYETWEECKAQVHGQEKSTFKKFKT-LDEARAAYAAGAPAPVDRKSS 61 Query: 391 *YTRNFK 411 TR+ K Sbjct: 62 PKTRSPK 68 >ref|WP_068456654.1| hypothetical protein [Peptoniphilus sp. KHD5] Length = 199 Score = 53.5 bits (127), Expect = 1e-05 Identities = 22/44 (50%), Positives = 29/44 (65%) Frame = +1 Query: 208 MRAIYVVFVGRRPGLYYDWNECAAQVTGYKKALFKRFSTQRRQR 339 M+ Y V VGR PG+Y DW+ C AQV G+K A++K F T+ R Sbjct: 1 MKKYYAVKVGREPGIYRDWDSCKAQVHGFKGAIYKSFKTEEEAR 44