BLASTX nr result
ID: Ophiopogon23_contig00024820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024820 (642 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65145.1| uncharacterized protein A4U43_C07F34150 [Asparagu... 59 9e-07 ref|XP_020272692.1| protein ROOT PRIMORDIUM DEFECTIVE 1-like, pa... 59 9e-07 >gb|ONK65145.1| uncharacterized protein A4U43_C07F34150 [Asparagus officinalis] Length = 357 Score = 59.3 bits (142), Expect = 9e-07 Identities = 36/76 (47%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = -1 Query: 576 NASRKSARQGPRGVQVEKNEPRRPYAKASLVDRRQASNTRRNGVQRKNSVEGKSHGRGNS 397 + SR+ +G RGV+VE EPRR SLV + N RR+ QRKN EG+S+GRGN+ Sbjct: 287 DGSRERVMEGRRGVRVENIEPRR-----SLVKESRGMNGRRHEGQRKNDGEGRSYGRGNN 341 Query: 396 -PRGKHRSQTRTRVST 352 +GK R R VST Sbjct: 342 FAQGKQRVNLRNMVST 357 >ref|XP_020272692.1| protein ROOT PRIMORDIUM DEFECTIVE 1-like, partial [Asparagus officinalis] Length = 359 Score = 59.3 bits (142), Expect = 9e-07 Identities = 36/76 (47%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = -1 Query: 576 NASRKSARQGPRGVQVEKNEPRRPYAKASLVDRRQASNTRRNGVQRKNSVEGKSHGRGNS 397 + SR+ +G RGV+VE EPRR SLV + N RR+ QRKN EG+S+GRGN+ Sbjct: 289 DGSRERVMEGRRGVRVENIEPRR-----SLVKESRGMNGRRHEGQRKNDGEGRSYGRGNN 343 Query: 396 -PRGKHRSQTRTRVST 352 +GK R R VST Sbjct: 344 FAQGKQRVNLRNMVST 359