BLASTX nr result
ID: Ophiopogon23_contig00024689
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024689 (821 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55050.1| uncharacterized protein A4U43_UnF8180 [Asparagus ... 79 7e-13 ref|XP_020250499.1| pentatricopeptide repeat-containing protein ... 79 1e-12 gb|KQK89900.1| hypothetical protein SETIT_039712mg, partial [Set... 60 1e-06 gb|OAY78460.1| Pentatricopeptide repeat-containing protein [Anan... 60 2e-06 gb|OEL21111.1| Pentatricopeptide repeat-containing protein [Dich... 58 7e-06 gb|PAN48461.1| hypothetical protein PAHAL_I04014 [Panicum hallii] 58 9e-06 >gb|ONK55050.1| uncharacterized protein A4U43_UnF8180 [Asparagus officinalis] Length = 395 Score = 78.6 bits (192), Expect = 7e-13 Identities = 44/85 (51%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = +2 Query: 278 ALELFREILSGSCPFYQDDGTIVSSMPVISSTGTIDFGPLLCSEEWV**EYQRFFLRKGV 457 ALELFRE+ S +CPF+ DD T+VS +P ISSTG ID G W+ R+ + G+ Sbjct: 87 ALELFRELQSAACPFHPDDVTVVSILPAISSTGMIDLG------RWI----HRYARKSGL 136 Query: 458 PM---F*LALMDMYFKCGDIQDARR 523 ALMDMYFKCGDIQ+ARR Sbjct: 137 DKKTNVATALMDMYFKCGDIQEARR 161 >ref|XP_020250499.1| pentatricopeptide repeat-containing protein At2g44880 [Asparagus officinalis] Length = 594 Score = 78.6 bits (192), Expect = 1e-12 Identities = 44/85 (51%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = +2 Query: 278 ALELFREILSGSCPFYQDDGTIVSSMPVISSTGTIDFGPLLCSEEWV**EYQRFFLRKGV 457 ALELFRE+ S +CPF+ DD T+VS +P ISSTG ID G W+ R+ + G+ Sbjct: 286 ALELFRELQSAACPFHPDDVTVVSILPAISSTGMIDLG------RWI----HRYARKSGL 335 Query: 458 PM---F*LALMDMYFKCGDIQDARR 523 ALMDMYFKCGDIQ+ARR Sbjct: 336 DKKTNVATALMDMYFKCGDIQEARR 360 >gb|KQK89900.1| hypothetical protein SETIT_039712mg, partial [Setaria italica] Length = 520 Score = 60.1 bits (144), Expect = 1e-06 Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 3/85 (3%) Frame = +2 Query: 278 ALELFREILSGSCPFYQDDGTIVSSMPVISSTGTIDFGPLLCSEEWV**EYQRFFLRKGV 457 AL+LFRE+ S SCPF ++ T+VS +P I+ TG +D G WV F RKG+ Sbjct: 227 ALKLFRELQSQSCPFEPNEVTLVSVIPAITDTGAMDLG------RWV----HEFARRKGL 276 Query: 458 PM---F*LALMDMYFKCGDIQDARR 523 AL+DMY KCG+ +A+R Sbjct: 277 DRRANVATALIDMYLKCGNADEAKR 301 >gb|OAY78460.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 622 Score = 60.1 bits (144), Expect = 2e-06 Identities = 37/84 (44%), Positives = 46/84 (54%), Gaps = 3/84 (3%) Frame = +2 Query: 278 ALELFREILSGSCPFYQDDGTIVSSMPVISSTGTIDFGPLLCSEEWV**EYQRFFLRKGV 457 AL+LFRE+ S SCPF D T+VS +P IS G ID G W+ + RKG Sbjct: 314 ALDLFRELQSNSCPFEPDAVTLVSIIPAISDMGAIDLG------RWI----HNYAKRKGF 363 Query: 458 PM---F*LALMDMYFKCGDIQDAR 520 AL+DMY KCGDI +A+ Sbjct: 364 DQRTNIVTALVDMYAKCGDICEAK 387 >gb|OEL21111.1| Pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 619 Score = 58.2 bits (139), Expect = 7e-06 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 3/85 (3%) Frame = +2 Query: 278 ALELFREILSGSCPFYQDDGTIVSSMPVISSTGTIDFGPLLCSEEWV**EYQRFFLRKGV 457 AL LFRE+ S SCPF ++ T VS +P I+ TG +D G WV F RKG+ Sbjct: 226 ALNLFRELQSQSCPFEPNEVTFVSVIPAITDTGAMDLG------RWV----HEFARRKGL 275 Query: 458 PMF---*LALMDMYFKCGDIQDARR 523 + +L+DMY KCG+ +ARR Sbjct: 276 DRWANVATSLIDMYSKCGNAGEARR 300 >gb|PAN48461.1| hypothetical protein PAHAL_I04014 [Panicum hallii] Length = 535 Score = 57.8 bits (138), Expect = 9e-06 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 3/85 (3%) Frame = +2 Query: 278 ALELFREILSGSCPFYQDDGTIVSSMPVISSTGTIDFGPLLCSEEWV**EYQRFFLRKGV 457 AL LFRE+ S SCPF ++ T+VS +P I+ TG +D G WV F RKG+ Sbjct: 227 ALNLFRELQSQSCPFEPNEVTLVSVIPAITDTGAMDLG------RWV----HEFARRKGL 276 Query: 458 PM---F*LALMDMYFKCGDIQDARR 523 AL+DMY KCG+ +A R Sbjct: 277 DRRANVATALIDMYSKCGNANEAMR 301