BLASTX nr result
ID: Ophiopogon23_contig00024512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024512 (707 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269193.1| uncharacterized protein LOC109844534 [Aspara... 64 3e-08 gb|ONK67415.1| uncharacterized protein A4U43_C06F19990 [Asparagu... 64 3e-08 >ref|XP_020269193.1| uncharacterized protein LOC109844534 [Asparagus officinalis] Length = 729 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -1 Query: 140 NSEKGS-PEEVQKSRDKEVKHSIHELDGSKDASALLNEELADES 12 NS GS PEEVQKS +KEV+HSIHE DGSKDA ALLNE+L DES Sbjct: 313 NSGNGSVPEEVQKSMNKEVEHSIHEQDGSKDAWALLNEDLTDES 356 >gb|ONK67415.1| uncharacterized protein A4U43_C06F19990 [Asparagus officinalis] Length = 737 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -1 Query: 140 NSEKGS-PEEVQKSRDKEVKHSIHELDGSKDASALLNEELADES 12 NS GS PEEVQKS +KEV+HSIHE DGSKDA ALLNE+L DES Sbjct: 313 NSGNGSVPEEVQKSMNKEVEHSIHEQDGSKDAWALLNEDLTDES 356