BLASTX nr result
ID: Ophiopogon23_contig00023543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00023543 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX96194.1| chloroplast envelope membrane protein (chloroplas... 84 1e-16 ref|YP_009335345.1| chloroplast envelope membrane protein, parti... 80 4e-15 ref|YP_009431230.1| chloroplast envelope membrane protein (chlor... 80 4e-15 ref|YP_009183211.1| envelope membrane protein (chloroplast) [Pol... 80 4e-15 gb|AEX96197.1| chloroplast envelope membrane protein (chloroplas... 80 4e-15 gb|AEX96193.1| chloroplast envelope membrane protein (chloroplas... 80 4e-15 gb|AEX96190.1| chloroplast envelope membrane protein (chloroplas... 80 4e-15 gb|AEJ10173.1| chloroplast envelope membrane protein, partial (p... 80 4e-15 gb|AEX96192.1| chloroplast envelope membrane protein (chloroplas... 80 5e-15 gb|AEX96196.1| chloroplast envelope membrane protein (chloroplas... 79 7e-15 ref|YP_009180120.1| envelope membrane protein (chloroplast) [Pol... 79 9e-15 gb|AEJ10153.1| chloroplast envelope membrane protein, partial (p... 78 2e-14 ref|YP_009335855.1| chloroplast envelope membrane protein, parti... 78 2e-14 ref|YP_009045578.1| chloroplast envelope protein Ycf10 (chloropl... 78 2e-14 ref|YP_009335770.1| chloroplast envelope membrane protein, parti... 78 2e-14 ref|YP_009335516.1| chloroplast envelope membrane protein (chlor... 78 2e-14 gb|APO11815.1| chloroplast envelope membrane protein, partial (c... 78 2e-14 gb|APO11732.1| chloroplast envelope membrane protein, partial (c... 78 2e-14 ref|YP_009334756.1| chloroplast envelope membrane protein, parti... 78 2e-14 gb|APO11398.1| chloroplast envelope membrane protein (chloroplas... 78 2e-14 >gb|AEX96194.1| chloroplast envelope membrane protein (chloroplast) [Ophiopogon japonicus] Length = 232 Score = 84.0 bits (206), Expect = 1e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >ref|YP_009335345.1| chloroplast envelope membrane protein, partial (chloroplast) [Nolina atopocarpa] gb|APO12403.1| chloroplast envelope membrane protein, partial (chloroplast) [Nolina atopocarpa] Length = 231 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 5 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 40 >ref|YP_009431230.1| chloroplast envelope membrane protein (chloroplast) [Maianthemum bicolor] gb|ASW26666.1| chloroplast envelope membrane protein (chloroplast) [Maianthemum bicolor] Length = 232 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >ref|YP_009183211.1| envelope membrane protein (chloroplast) [Polygonatum verticillatum] ref|YP_009236372.1| envelope membrane protein (chloroplast) [Polygonatum sibiricum] ref|YP_009432315.1| chloroplast envelope membrane protein (chloroplast) [Polygonatum stenophyllum] gb|ALM87743.1| envelope membrane protein (chloroplast) [Polygonatum verticillatum] gb|AMF84099.1| envelope membrane protein (chloroplast) [Polygonatum sibiricum] gb|ATB18570.1| chloroplast envelope membrane protein (chloroplast) [Polygonatum stenophyllum] Length = 232 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|AEX96197.1| chloroplast envelope membrane protein (chloroplast) [Maianthemum stellatum] Length = 232 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|AEX96193.1| chloroplast envelope membrane protein (chloroplast) [Liriope spicata] Length = 232 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|AEX96190.1| chloroplast envelope membrane protein (chloroplast) [Beaucarnea hookeri] Length = 232 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|AEJ10173.1| chloroplast envelope membrane protein, partial (plastid) [Nolina atopocarpa] Length = 232 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|AEX96192.1| chloroplast envelope membrane protein (chloroplast) [Eriospermum cervicorne] Length = 229 Score = 79.7 bits (195), Expect = 5e-15 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL SPPYLASIVFLPWWVSLS QKSLEPWIINWWNT Sbjct: 6 ALTSPPYLASIVFLPWWVSLSLQKSLEPWIINWWNT 41 >gb|AEX96196.1| chloroplast envelope membrane protein (chloroplast) [Sansevieria trifasciata] Length = 232 Score = 79.3 bits (194), Expect = 7e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 ALIS PY+ASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALISLPYIASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >ref|YP_009180120.1| envelope membrane protein (chloroplast) [Polygonatum cyrtonema] gb|ALL96501.1| envelope membrane protein (chloroplast) [Polygonatum cyrtonema] Length = 229 Score = 79.0 bits (193), Expect = 9e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 +LIS PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 SLISLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|AEJ10153.1| chloroplast envelope membrane protein, partial (plastid) [Chlorophytum rhizopendulum] Length = 227 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 4 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 39 >ref|YP_009335855.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca schidigera] gb|APO12999.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca schidigera] Length = 228 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 5 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 40 >ref|YP_009045578.1| chloroplast envelope protein Ycf10 (chloroplast) [Cypripedium macranthos] ref|YP_009335176.1| chloroplast envelope membrane protein (chloroplast) [Hosta ventricosa] ref|YP_009432653.1| chloroplast envelope membrane protein (chloroplast) [Hosta minor] gb|AEJ10163.1| chloroplast envelope membrane protein, partial (plastid) [Hosta ventricosa] gb|AEX96162.1| chloroplast envelope membrane protein (chloroplast) [Hosta ventricosa] gb|AHI16761.1| chloroplast envelope protein Ycf10 (chloroplast) (chloroplast) [Cypripedium macranthos] gb|APO12234.1| chloroplast envelope membrane protein (chloroplast) [Hosta ventricosa] gb|ATB18889.1| chloroplast envelope membrane protein (chloroplast) [Hosta minor] Length = 228 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >ref|YP_009335770.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca queretaroensis] gb|APO12914.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca queretaroensis] Length = 229 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >ref|YP_009335516.1| chloroplast envelope membrane protein (chloroplast) [Schoenolirion croceum] gb|APO12660.1| chloroplast envelope membrane protein (chloroplast) [Schoenolirion croceum] Length = 229 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|APO11815.1| chloroplast envelope membrane protein, partial (chloroplast) [Echeandia sp. Steele 1101] Length = 229 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|APO11732.1| chloroplast envelope membrane protein, partial (chloroplast) [Chlorophytum rhizopendulum] Length = 229 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >ref|YP_009334756.1| chloroplast envelope membrane protein, partial (chloroplast) [Chlorogalum pomeridianum] ref|YP_009335600.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca brevifolia] ref|YP_009335685.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca filamentosa] gb|APO11649.1| chloroplast envelope membrane protein, partial (chloroplast) [Chlorogalum pomeridianum] gb|APO12744.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca brevifolia] gb|APO12829.1| chloroplast envelope membrane protein, partial (chloroplast) [Yucca filamentosa] Length = 229 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41 >gb|APO11398.1| chloroplast envelope membrane protein (chloroplast) [Behnia reticulata] Length = 229 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 109 ALISPPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 2 AL S PYLASIVFLPWWVSLSFQKSLEPWIINWWNT Sbjct: 6 ALTSLPYLASIVFLPWWVSLSFQKSLEPWIINWWNT 41