BLASTX nr result
ID: Ophiopogon23_contig00022984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00022984 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270484.1| beta-glucosidase 25 [Asparagus officinalis] 57 3e-06 >ref|XP_020270484.1| beta-glucosidase 25 [Asparagus officinalis] Length = 515 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 180 MDLTWRATLIVCLAFGFLTTAQAISRADFPNGFVFGTASSAYQ 52 M WRATL++ L F F T +AI R++FP+ FVFGTASSAYQ Sbjct: 1 MAFIWRATLMLYLGFSFFFTIEAIDRSEFPDNFVFGTASSAYQ 43