BLASTX nr result
ID: Ophiopogon23_contig00022956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00022956 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008804313.1| PREDICTED: uncharacterized protein LOC103717... 56 3e-06 >ref|XP_008804313.1| PREDICTED: uncharacterized protein LOC103717631 [Phoenix dactylifera] Length = 297 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = -1 Query: 318 IYVAWQAQLPRWLKLNFDGSSFQVGGEGGAGFILRDHFGKALVARSYPRRRLLVPIVELI 139 ++ +W P +LK++FDGS G GG GF++RDH G+ +VA L + EL Sbjct: 125 VFASWVPPPPGYLKVSFDGSVALEGRSGGVGFVIRDHLGRLVVAGGRCTPGLTIVGAELR 184 Query: 138 GAWSSVFF---*LWARRI*LDG 82 AW V + L ARR+ L+G Sbjct: 185 AAWEGVSYTRRVLGARRVHLEG 206