BLASTX nr result
ID: Ophiopogon23_contig00022885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00022885 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268282.1| pentatricopeptide repeat-containing protein ... 74 6e-13 >ref|XP_020268282.1| pentatricopeptide repeat-containing protein At4g38150 [Asparagus officinalis] gb|ONK68766.1| uncharacterized protein A4U43_C05F15780 [Asparagus officinalis] Length = 360 Score = 73.9 bits (180), Expect = 6e-13 Identities = 49/109 (44%), Positives = 57/109 (52%) Frame = +3 Query: 18 MQPKIFRALFSNLPRKSSHSPKSPILEKSPCLLALVHFSTVPNGPMRGGEGHRRRDDQGS 197 MQP+I + LFSNL K +H PKSP+ E SP L ++ HFST P PMRG R S Sbjct: 1 MQPRISKTLFSNLLSKFAHLPKSPVTENSPSLASVAHFSTNPGRPMRGDS---MRHGNES 57 Query: 198 EGDFLRNLNFXXXXXXXXXXHKPHQXXXXXXXXXXIRGGDQRPMRGDRR 344 E +FLRNLNF KP Q R DQ P+ GDRR Sbjct: 58 EENFLRNLNF-EGKRDRDDAEKPRQNPRS-------RHPDQ-PLSGDRR 97