BLASTX nr result
ID: Ophiopogon23_contig00022848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00022848 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65228.1| uncharacterized protein A4U43_C07F34990 [Asparagu... 55 2e-06 >gb|ONK65228.1| uncharacterized protein A4U43_C07F34990 [Asparagus officinalis] Length = 201 Score = 54.7 bits (130), Expect = 2e-06 Identities = 38/116 (32%), Positives = 50/116 (43%) Frame = -2 Query: 350 SPVPYTPHQRKSSSCDDGEIRNDRHDXXXXXXXXXXXXXXXXXXRDGRLVGXXXXXXXXX 171 SP+ P +R +S DDGEIR+D+ Sbjct: 104 SPIRGQPSRRSPASYDDGEIRDDQLHRSEIPSDDPAP----------------------- 140 Query: 170 XXPYIDNGRREGSCSPGQWHQRSPNCPNDVEEPSIKNQPARSSHDGEEEEEGMILP 3 Y+DN RRE S SP WHQ+ N +EP +P RS+ G+E EEGMI+P Sbjct: 141 ---YVDNERREASPSPISWHQKFQNPRPSNDEPV---RPQRSATGGDEAEEGMIMP 190