BLASTX nr result
ID: Ophiopogon23_contig00021987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00021987 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256683.1| protein CHLOROPLAST ENHANCING STRESS TOLERAN... 55 1e-07 gb|ONK74880.1| uncharacterized protein A4U43_C03F11070 [Asparagu... 55 1e-07 >ref|XP_020256683.1| protein CHLOROPLAST ENHANCING STRESS TOLERANCE, chloroplastic [Asparagus officinalis] Length = 254 Score = 55.1 bits (131), Expect(2) = 1e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +1 Query: 127 QSDPVFSVGQDETELRVSTDEEEPQKQDGGEAIEEALASPEDLEYVEQIKRV 282 ++ PVFSVG +E ELRVS DE++ Q + E ++E A+PEDLE+VEQIKRV Sbjct: 44 RAGPVFSVGNEEAELRVSVDEQKQQTE--VEEVQE--ATPEDLEHVEQIKRV 91 Score = 28.1 bits (61), Expect(2) = 1e-07 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 366 LGFLRKNRDMTFGEV 410 L LR+NRDMTFGEV Sbjct: 92 LELLRRNRDMTFGEV 106 >gb|ONK74880.1| uncharacterized protein A4U43_C03F11070 [Asparagus officinalis] Length = 150 Score = 55.1 bits (131), Expect(2) = 1e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +1 Query: 127 QSDPVFSVGQDETELRVSTDEEEPQKQDGGEAIEEALASPEDLEYVEQIKRV 282 ++ PVFSVG +E ELRVS DE++ Q + E ++E A+PEDLE+VEQIKRV Sbjct: 44 RAGPVFSVGNEEAELRVSVDEQKQQTE--VEEVQE--ATPEDLEHVEQIKRV 91 Score = 28.1 bits (61), Expect(2) = 1e-07 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 366 LGFLRKNRDMTFGEV 410 L LR+NRDMTFGEV Sbjct: 92 LELLRRNRDMTFGEV 106