BLASTX nr result
ID: Ophiopogon23_contig00020913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00020913 (710 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248789.1| probable transcriptional regulator SLK2 [Asp... 64 5e-08 gb|ONK56636.1| uncharacterized protein A4U43_C10F11050 [Asparagu... 64 5e-08 >ref|XP_020248789.1| probable transcriptional regulator SLK2 [Asparagus officinalis] Length = 712 Score = 63.9 bits (154), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 514 FNGKPDLLQNLHLPELDQDILREFTESGIQW 422 F+ KPDLLQNLHLPELDQDILREFTESGIQW Sbjct: 682 FDVKPDLLQNLHLPELDQDILREFTESGIQW 712 >gb|ONK56636.1| uncharacterized protein A4U43_C10F11050 [Asparagus officinalis] Length = 768 Score = 63.9 bits (154), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 514 FNGKPDLLQNLHLPELDQDILREFTESGIQW 422 F+ KPDLLQNLHLPELDQDILREFTESGIQW Sbjct: 738 FDVKPDLLQNLHLPELDQDILREFTESGIQW 768