BLASTX nr result
ID: Ophiopogon23_contig00020647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00020647 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264403.1| calcium/calmodulin-regulated receptor-like k... 84 6e-16 ref|XP_020264402.1| calcium/calmodulin-regulated receptor-like k... 84 6e-16 >ref|XP_020264403.1| calcium/calmodulin-regulated receptor-like kinase 2 isoform X2 [Asparagus officinalis] gb|ONK69391.1| uncharacterized protein A4U43_C05F22370 [Asparagus officinalis] Length = 429 Score = 84.3 bits (207), Expect = 6e-16 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 508 RIGRRRLNKDEALSISGTVNALGFLRRLERQHVELSHLTSIKESPAAV 365 RIGRRRLN+DE LSI+G++NALGFL+RLERQ VELSHLTSIKESPAAV Sbjct: 381 RIGRRRLNRDETLSIAGSINALGFLKRLERQQVELSHLTSIKESPAAV 428 >ref|XP_020264402.1| calcium/calmodulin-regulated receptor-like kinase 2 isoform X1 [Asparagus officinalis] Length = 431 Score = 84.3 bits (207), Expect = 6e-16 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 508 RIGRRRLNKDEALSISGTVNALGFLRRLERQHVELSHLTSIKESPAAV 365 RIGRRRLN+DE LSI+G++NALGFL+RLERQ VELSHLTSIKESPAAV Sbjct: 383 RIGRRRLNRDETLSIAGSINALGFLKRLERQQVELSHLTSIKESPAAV 430