BLASTX nr result
ID: Ophiopogon23_contig00020558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00020558 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264055.1| ribonuclease 3-like protein 2, partial [Aspa... 61 4e-08 >ref|XP_020264055.1| ribonuclease 3-like protein 2, partial [Asparagus officinalis] Length = 333 Score = 61.2 bits (147), Expect = 4e-08 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 256 ERGSAHGKKFLCYIRVVILNKEYINVGDLKARVKDAENTTATKMLSEI 399 E G H KKF C ++V I NKEY VGDLK+R++D+EN+ A K+L+EI Sbjct: 283 EEGPPHDKKFACSVQVRISNKEYFEVGDLKSRIRDSENSAAAKVLAEI 330