BLASTX nr result
ID: Ophiopogon23_contig00019172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00019172 (559 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020263628.1| DNA excision repair protein ERCC-1 [Asparagu... 61 1e-07 >ref|XP_020263628.1| DNA excision repair protein ERCC-1 [Asparagus officinalis] gb|ONK73660.1| uncharacterized protein A4U43_C04F33940 [Asparagus officinalis] Length = 381 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 515 KKEHKPNVKSALSAAFAKYADRVQKPEGRSSPPEMGEGSNSSAMASK 375 +KEH NVKSALSAAFAKYA+RV+KP+ +SS PE EGS+S A K Sbjct: 335 RKEHTLNVKSALSAAFAKYAERVRKPDEKSSSPEKVEGSSSVTAAPK 381