BLASTX nr result
ID: Ophiopogon23_contig00019021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00019021 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257944.1| pentatricopeptide repeat-containing protein ... 123 4e-30 ref|XP_017702069.1| PREDICTED: pentatricopeptide repeat-containi... 71 6e-12 ref|XP_008811661.1| PREDICTED: pentatricopeptide repeat-containi... 71 6e-12 ref|XP_008811660.1| PREDICTED: pentatricopeptide repeat-containi... 71 6e-12 ref|XP_010938990.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_010938989.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 >ref|XP_020257944.1| pentatricopeptide repeat-containing protein At5g67570, chloroplastic [Asparagus officinalis] gb|ONK76175.1| uncharacterized protein A4U43_C03F24720 [Asparagus officinalis] Length = 875 Score = 123 bits (308), Expect = 4e-30 Identities = 65/99 (65%), Positives = 78/99 (78%), Gaps = 2/99 (2%) Frame = -1 Query: 357 RHTT-VHLEERIDFDALSSSTTGNEGKHPDSYQKGKSNSSVGES-FDSLTDNVDSSFSEL 184 RH T V+L E +DFD SSS+ GNEGK +S QKG S+S GES FD LTDN+D SFS+L Sbjct: 776 RHDTDVNLLEGVDFDVFSSSSIGNEGKWSESTQKGHSDSPNGESCFDLLTDNIDDSFSKL 835 Query: 183 PSASDILDTWKKDRIKDGIFPFEYINSINQ*REHNGECY 67 PSASDIL+TWKKDRIKDGIFPFEY++S Q R ++ EC+ Sbjct: 836 PSASDILETWKKDRIKDGIFPFEYMSSNIQWRTYDEECH 874 >ref|XP_017702069.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic isoform X3 [Phoenix dactylifera] Length = 797 Score = 71.2 bits (173), Expect = 6e-12 Identities = 36/79 (45%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = -1 Query: 348 TVHLEERIDFDALSSSTTGNEGKHPDSYQKGKSNSSVGES-FDSLTDNVDSSFSELPSAS 172 ++ L+ER++ + SSS GNEG +S G + + + ++ +SLT + FSE+PSAS Sbjct: 719 SISLQERVN-NVASSSFAGNEGNELNSVFHGYTETPITDAALNSLTADTGRPFSEMPSAS 777 Query: 171 DILDTWKKDRIKDGIFPFE 115 +IL+TWK+DR+KDGIFPF+ Sbjct: 778 EILETWKQDRLKDGIFPFQ 796 >ref|XP_008811661.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic isoform X2 [Phoenix dactylifera] Length = 871 Score = 71.2 bits (173), Expect = 6e-12 Identities = 36/79 (45%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = -1 Query: 348 TVHLEERIDFDALSSSTTGNEGKHPDSYQKGKSNSSVGES-FDSLTDNVDSSFSELPSAS 172 ++ L+ER++ + SSS GNEG +S G + + + ++ +SLT + FSE+PSAS Sbjct: 793 SISLQERVN-NVASSSFAGNEGNELNSVFHGYTETPITDAALNSLTADTGRPFSEMPSAS 851 Query: 171 DILDTWKKDRIKDGIFPFE 115 +IL+TWK+DR+KDGIFPF+ Sbjct: 852 EILETWKQDRLKDGIFPFQ 870 >ref|XP_008811660.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic isoform X1 [Phoenix dactylifera] Length = 881 Score = 71.2 bits (173), Expect = 6e-12 Identities = 36/79 (45%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = -1 Query: 348 TVHLEERIDFDALSSSTTGNEGKHPDSYQKGKSNSSVGES-FDSLTDNVDSSFSELPSAS 172 ++ L+ER++ + SSS GNEG +S G + + + ++ +SLT + FSE+PSAS Sbjct: 803 SISLQERVN-NVASSSFAGNEGNELNSVFHGYTETPITDAALNSLTADTGRPFSEMPSAS 861 Query: 171 DILDTWKKDRIKDGIFPFE 115 +IL+TWK+DR+KDGIFPF+ Sbjct: 862 EILETWKQDRLKDGIFPFQ 880 >ref|XP_010938990.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic isoform X2 [Elaeis guineensis] Length = 871 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = -1 Query: 306 SSTTGNEGKHPDSYQKGKSNSSVGES-FDSLTDNVDSSFSELPSASDILDTWKKDRIKDG 130 SS GNEGK S G S + + ++ +SLT + FSELPSA +IL+TWK++R+KDG Sbjct: 806 SSFVGNEGKELHSVFHGYSETPITDAALESLTAHTGRPFSELPSAFEILETWKQERMKDG 865 Query: 129 IFPFE 115 IFPF+ Sbjct: 866 IFPFQ 870 >ref|XP_010938989.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic isoform X1 [Elaeis guineensis] Length = 881 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = -1 Query: 306 SSTTGNEGKHPDSYQKGKSNSSVGES-FDSLTDNVDSSFSELPSASDILDTWKKDRIKDG 130 SS GNEGK S G S + + ++ +SLT + FSELPSA +IL+TWK++R+KDG Sbjct: 816 SSFVGNEGKELHSVFHGYSETPITDAALESLTAHTGRPFSELPSAFEILETWKQERMKDG 875 Query: 129 IFPFE 115 IFPF+ Sbjct: 876 IFPFQ 880