BLASTX nr result
ID: Ophiopogon23_contig00018953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018953 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021290780.1| cysteine synthase, chloroplastic/chromoplast... 51 6e-13 ref|XP_022151913.1| cysteine synthase [Momordica charantia] 51 6e-13 ref|XP_010930274.1| PREDICTED: cysteine synthase [Elaeis guineen... 53 6e-13 ref|XP_022998057.1| cysteine synthase, chloroplastic/chromoplast... 51 6e-13 ref|XP_022956416.1| cysteine synthase, chloroplastic/chromoplast... 51 6e-13 ref|XP_015870012.1| PREDICTED: cysteine synthase-like [Ziziphus ... 51 6e-13 gb|EOY04650.1| O-acetylserine lyase B isoform 2 [Theobroma cacao] 51 8e-13 ref|XP_007033723.2| PREDICTED: cysteine synthase, chloroplastic/... 51 8e-13 gb|EOY04649.1| O-acetylserine lyase B isoform 1 [Theobroma cacao] 51 8e-13 ref|XP_008800744.1| PREDICTED: cysteine synthase-like [Phoenix d... 53 8e-13 ref|XP_024194563.1| cysteine synthase, chloroplastic/chromoplast... 51 1e-12 ref|XP_022733871.1| cysteine synthase, chloroplastic/chromoplast... 50 2e-12 ref|XP_004309642.1| PREDICTED: cysteine synthase [Fragaria vesca... 51 2e-12 gb|PPD87948.1| hypothetical protein GOBAR_DD15136 [Gossypium bar... 50 2e-12 ref|XP_018840433.1| PREDICTED: cysteine synthase, chloroplastic/... 51 3e-12 ref|XP_018840435.1| PREDICTED: cysteine synthase isoform X2 [Jug... 51 3e-12 ref|XP_022945859.1| cysteine synthase-like isoform X1 [Cucurbita... 50 5e-12 ref|XP_011037378.1| PREDICTED: cysteine synthase [Populus euphra... 50 5e-12 ref|XP_006376449.1| hypothetical protein POPTR_0013s13150g [Popu... 50 5e-12 ref|XP_009416025.1| PREDICTED: cysteine synthase [Musa acuminata... 52 5e-12 >ref|XP_021290780.1| cysteine synthase, chloroplastic/chromoplastic-like [Herrania umbratica] Length = 402 Score = 51.2 bits (121), Expect(2) = 6e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 234 Score = 50.1 bits (118), Expect(2) = 6e-13 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEPT+SN+ SGG+PG Sbjct: 272 FLKEKNPKIKVIGIEPTESNILSGGKPG 299 >ref|XP_022151913.1| cysteine synthase [Momordica charantia] Length = 400 Score = 51.2 bits (121), Expect(2) = 6e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK N+YMLQQFDNPANP Sbjct: 203 MKGAVQKAEEILKKTPNSYMLQQFDNPANP 232 Score = 50.1 bits (118), Expect(2) = 6e-13 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEPT+SN+ SGG+PG Sbjct: 270 FLKQKNPKIKVIGIEPTESNILSGGKPG 297 >ref|XP_010930274.1| PREDICTED: cysteine synthase [Elaeis guineensis] Length = 397 Score = 53.1 bits (126), Expect(2) = 6e-13 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILKN N YMLQQFDNPANP Sbjct: 200 MKGAVQKAEEILKNTPNAYMLQQFDNPANP 229 Score = 48.1 bits (113), Expect(2) = 6e-13 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEP +SN+ SGG+PG Sbjct: 267 FLKGKNPKIKVIGIEPAESNILSGGKPG 294 >ref|XP_022998057.1| cysteine synthase, chloroplastic/chromoplastic [Cucurbita maxima] Length = 396 Score = 51.2 bits (121), Expect(2) = 6e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK N+YMLQQFDNPANP Sbjct: 199 MKGAVQKAEEILKKTPNSYMLQQFDNPANP 228 Score = 50.1 bits (118), Expect(2) = 6e-13 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEPT+SN+ SGG+PG Sbjct: 266 FLKQKNPKIKVIGIEPTESNILSGGKPG 293 >ref|XP_022956416.1| cysteine synthase, chloroplastic/chromoplastic [Cucurbita moschata] ref|XP_023535042.1| cysteine synthase, chloroplastic/chromoplastic [Cucurbita pepo subsp. pepo] Length = 396 Score = 51.2 bits (121), Expect(2) = 6e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK N+YMLQQFDNPANP Sbjct: 199 MKGAVQKAEEILKKTPNSYMLQQFDNPANP 228 Score = 50.1 bits (118), Expect(2) = 6e-13 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEPT+SN+ SGG+PG Sbjct: 266 FLKQKNPKIKVIGIEPTESNILSGGKPG 293 >ref|XP_015870012.1| PREDICTED: cysteine synthase-like [Ziziphus jujuba] Length = 390 Score = 51.2 bits (121), Expect(2) = 6e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 193 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 222 Score = 50.1 bits (118), Expect(2) = 6e-13 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEPT+SN+ SGG+PG Sbjct: 260 FLKQKNPKIKVIGIEPTESNILSGGKPG 287 >gb|EOY04650.1| O-acetylserine lyase B isoform 2 [Theobroma cacao] Length = 409 Score = 51.2 bits (121), Expect(2) = 8e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 234 Score = 49.7 bits (117), Expect(2) = 8e-13 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIG+EPT+SN+ SGG+PG Sbjct: 272 FLKEKNPKIKVIGVEPTESNILSGGKPG 299 >ref|XP_007033723.2| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Theobroma cacao] Length = 402 Score = 51.2 bits (121), Expect(2) = 8e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 234 Score = 49.7 bits (117), Expect(2) = 8e-13 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIG+EPT+SN+ SGG+PG Sbjct: 272 FLKEKNPKIKVIGVEPTESNILSGGKPG 299 >gb|EOY04649.1| O-acetylserine lyase B isoform 1 [Theobroma cacao] Length = 402 Score = 51.2 bits (121), Expect(2) = 8e-13 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 234 Score = 49.7 bits (117), Expect(2) = 8e-13 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIG+EPT+SN+ SGG+PG Sbjct: 272 FLKEKNPKIKVIGVEPTESNILSGGKPG 299 >ref|XP_008800744.1| PREDICTED: cysteine synthase-like [Phoenix dactylifera] Length = 397 Score = 53.1 bits (126), Expect(2) = 8e-13 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILKN N YMLQQFDNPANP Sbjct: 200 MKGAVQKAEEILKNTPNAYMLQQFDNPANP 229 Score = 47.8 bits (112), Expect(2) = 8e-13 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLKSK P +KVIGIEP +SN+ SGG+PG Sbjct: 267 FLKSKNPNIKVIGIEPAESNILSGGKPG 294 >ref|XP_024194563.1| cysteine synthase, chloroplastic/chromoplastic [Rosa chinensis] gb|PRQ37718.1| putative cysteine synthase [Rosa chinensis] Length = 385 Score = 51.2 bits (121), Expect(2) = 1e-12 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 188 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 217 Score = 49.3 bits (116), Expect(2) = 1e-12 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+K+IG+EPT+SN+ SGG+PG Sbjct: 255 FLKEKNPKIKIIGVEPTESNILSGGKPG 282 >ref|XP_022733871.1| cysteine synthase, chloroplastic/chromoplastic-like [Durio zibethinus] Length = 395 Score = 50.1 bits (118), Expect(2) = 2e-12 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNP+NP Sbjct: 198 MKGAVQKAEEILKSTPNAYMLQQFDNPSNP 227 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIG+EPT+SN+ SGG+PG Sbjct: 265 FLKEKNPKIKVIGVEPTESNILSGGKPG 292 >ref|XP_004309642.1| PREDICTED: cysteine synthase [Fragaria vesca subsp. vesca] Length = 397 Score = 51.2 bits (121), Expect(2) = 2e-12 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 200 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 229 Score = 48.1 bits (113), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K P++K+IG+EPT+SN+ SGG+PG Sbjct: 267 FLKEKNPRIKIIGVEPTESNILSGGKPG 294 >gb|PPD87948.1| hypothetical protein GOBAR_DD15136 [Gossypium barbadense] Length = 396 Score = 50.1 bits (118), Expect(2) = 2e-12 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EI+K+ N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEIVKSTHNAYMLQQFDNPANP 234 Score = 49.3 bits (116), Expect(2) = 2e-12 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPGI 222 FLK K P +KVIG+EPT+SN+ SGG+PGI Sbjct: 272 FLKEKNPNIKVIGVEPTESNILSGGKPGI 300 >ref|XP_018840433.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform X1 [Juglans regia] ref|XP_018840434.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform X1 [Juglans regia] Length = 395 Score = 51.2 bits (121), Expect(2) = 3e-12 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 198 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 227 Score = 47.8 bits (112), Expect(2) = 3e-12 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEP +SN+ SGG+PG Sbjct: 265 FLKQKNPKIKVIGIEPLESNILSGGKPG 292 >ref|XP_018840435.1| PREDICTED: cysteine synthase isoform X2 [Juglans regia] Length = 387 Score = 51.2 bits (121), Expect(2) = 3e-12 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK+ N YMLQQFDNPANP Sbjct: 198 MKGAVQKAEEILKSTPNAYMLQQFDNPANP 227 Score = 47.8 bits (112), Expect(2) = 3e-12 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEP +SN+ SGG+PG Sbjct: 265 FLKQKNPKIKVIGIEPLESNILSGGKPG 292 >ref|XP_022945859.1| cysteine synthase-like isoform X1 [Cucurbita moschata] Length = 422 Score = 50.1 bits (118), Expect(2) = 5e-12 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEPT+SN+ SGG+PG Sbjct: 266 FLKQKNPKIKVIGIEPTESNILSGGKPG 293 Score = 48.1 bits (113), Expect(2) = 5e-12 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK N+YMLQQFDN ANP Sbjct: 199 MKGAVQKAEEILKKTPNSYMLQQFDNSANP 228 >ref|XP_011037378.1| PREDICTED: cysteine synthase [Populus euphratica] Length = 402 Score = 49.7 bits (117), Expect(2) = 5e-12 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EI+K N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEIVKRTPNAYMLQQFDNPANP 234 Score = 48.5 bits (114), Expect(2) = 5e-12 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEP++SN+ SGG+PG Sbjct: 272 FLKEKNPKIKVIGIEPSESNILSGGKPG 299 >ref|XP_006376449.1| hypothetical protein POPTR_0013s13150g [Populus trichocarpa] gb|ABK96537.1| unknown [Populus trichocarpa x Populus deltoides] gb|PNT08097.1| hypothetical protein POPTR_013G127800v3 [Populus trichocarpa] Length = 402 Score = 49.7 bits (117), Expect(2) = 5e-12 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EI+K N YMLQQFDNPANP Sbjct: 205 MKGAVQKAEEIVKRTPNAYMLQQFDNPANP 234 Score = 48.5 bits (114), Expect(2) = 5e-12 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K PK+KVIGIEP++SN+ SGG+PG Sbjct: 272 FLKEKNPKIKVIGIEPSESNILSGGKPG 299 >ref|XP_009416025.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis] Length = 397 Score = 51.6 bits (122), Expect(2) = 5e-12 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 5 MKGALQKA*EILKNALNTYMLQQFDNPANP 94 MKGA+QKA EILK N YMLQQFDNPANP Sbjct: 200 MKGAVQKAEEILKKTTNAYMLQQFDNPANP 229 Score = 46.6 bits (109), Expect(2) = 5e-12 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = +1 Query: 136 FLKSKKPKMKVIGIEPTKSNVFSGGRPG 219 FLK K P +KVIGIEP++SN+ SGG+PG Sbjct: 267 FLKEKNPNIKVIGIEPSESNILSGGKPG 294