BLASTX nr result
ID: Ophiopogon23_contig00018818
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018818 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276077.1| uncharacterized protein LOC109850472 [Aspara... 52 2e-06 >ref|XP_020276077.1| uncharacterized protein LOC109850472 [Asparagus officinalis] Length = 73 Score = 52.0 bits (123), Expect = 2e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 370 FYNGSLSAFEFYNSHVKPKLLAGRNFGIGGN 278 FYNGS SA EFY +HVKPKLL G NFGIG N Sbjct: 40 FYNGSRSASEFYTNHVKPKLLDGGNFGIGRN 70