BLASTX nr result
ID: Ophiopogon23_contig00017947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017947 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250827.1| ankyrin repeat, bromo and BTB domain-contain... 56 3e-06 >ref|XP_020250827.1| ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 [Asparagus officinalis] gb|ONK54800.1| uncharacterized protein A4U43_UnF11190 [Asparagus officinalis] Length = 597 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 423 LWNGPHSLMRRHVPSTRDHGPIHAALAAFMQQ 328 +WNGPHSLM+RHV STRD PIHAALAAFM+Q Sbjct: 567 VWNGPHSLMQRHVASTRD-SPIHAALAAFMKQ 597