BLASTX nr result
ID: Ophiopogon23_contig00017462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017462 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245954.1| mediator-associated protein 2 [Asparagus off... 89 2e-19 >ref|XP_020245954.1| mediator-associated protein 2 [Asparagus officinalis] gb|ONK58635.1| uncharacterized protein A4U43_C09F15080 [Asparagus officinalis] Length = 219 Score = 89.0 bits (219), Expect(2) = 2e-19 Identities = 44/71 (61%), Positives = 57/71 (80%) Frame = -3 Query: 344 SSSHRSTVLRGTNGTSRDTVAFGHSTDMETPKPSKKKKYDDHRSAEGSPRGCRPDSQVTD 165 SSSHRSTVL+G+ GT+ DT F HST+ ETP+PS+KK+ ++HRS +GS RG RPDS +TD Sbjct: 138 SSSHRSTVLKGSKGTA-DTFNFPHSTE-ETPQPSRKKRREEHRSGDGSSRGSRPDSHLTD 195 Query: 164 TFVVSERSHGD 132 + S+RSHGD Sbjct: 196 GSLASDRSHGD 206 Score = 34.7 bits (78), Expect(2) = 2e-19 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 427 RHYPEPDELEKPSLRNLNLSSQRGSEKGA 341 RHYPEP+E E P+ N S+ RGS + + Sbjct: 111 RHYPEPEEFELPTFSNATRSNLRGSGRSS 139