BLASTX nr result
ID: Ophiopogon23_contig00017088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017088 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268801.1| K(+) efflux antiporter 3, chloroplastic [Asp... 54 7e-06 >ref|XP_020268801.1| K(+) efflux antiporter 3, chloroplastic [Asparagus officinalis] Length = 813 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -1 Query: 128 MADCRCLLQGGIVGDQIFPVRAYQYVFSSHHRGFHSISSYCK 3 MADC C+L+ +VGD I +RAYQ+VFSSHHR F+ IS Y K Sbjct: 1 MADCSCVLKV-VVGDPIRSIRAYQHVFSSHHRPFYGISPYRK 41