BLASTX nr result
ID: Ophiopogon23_contig00016338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00016338 (746 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRG92843.1| hypothetical protein GLYMA_20G233500 [Glycine max] 58 1e-06 gb|OAY66514.1| Protein YIPF [Ananas comosus] 58 5e-06 >gb|KRG92843.1| hypothetical protein GLYMA_20G233500 [Glycine max] Length = 191 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 IYRYGPFWICTTLIFVAAAIGTFVTY 2 +YRYGPFWICTTLIFVAA+IGTFVTY Sbjct: 32 VYRYGPFWICTTLIFVAASIGTFVTY 57 >gb|OAY66514.1| Protein YIPF [Ananas comosus] Length = 335 Score = 57.8 bits (138), Expect = 5e-06 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -2 Query: 142 LSDSCSCINLCILVSL*LLNYIYRYGPFWICTTLIFVAAAIGTFVTY 2 +S+SC C + + LL RYGPFWICTTLIFVAAAIGTFVTY Sbjct: 160 ISNSC-----CFMAMIYLLQ---RYGPFWICTTLIFVAAAIGTFVTY 198