BLASTX nr result
ID: Ophiopogon23_contig00016112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00016112 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POO03613.1| hypothetical protein TorRG33x02_008180 [Trema ori... 77 4e-16 gb|PNX64922.1| electron transfer flavoprotein-ubiquinone oxidore... 79 5e-16 gb|PON63957.1| hypothetical protein PanWU01x14_127240 [Parasponi... 77 1e-15 ref|XP_013465448.1| electron transfer flavoprotein ubiquinone ox... 82 2e-15 ref|XP_021906835.1| electron transfer flavoprotein-ubiquinone ox... 82 2e-15 ref|XP_013465446.1| electron transfer flavoprotein ubiquinone ox... 82 2e-15 ref|XP_021906834.1| electron transfer flavoprotein-ubiquinone ox... 82 2e-15 ref|XP_013465447.1| electron transfer flavoprotein ubiquinone ox... 82 2e-15 ref|XP_003597528.2| electron transfer flavoprotein ubiquinone ox... 82 2e-15 gb|POO03611.1| Electron transfer flavoprotein-ubiquinone oxidore... 82 2e-15 gb|PON63954.1| Electron transfer flavoprotein-ubiquinone oxidore... 82 2e-15 ref|XP_013686185.1| electron transfer flavoprotein-ubiquinone ox... 82 3e-15 dbj|GAV87292.1| FAD_binding_2 domain-containing protein, partial... 80 3e-15 ref|XP_008222598.1| PREDICTED: electron transfer flavoprotein-ub... 82 3e-15 ref|XP_007226965.1| electron transfer flavoprotein-ubiquinone ox... 82 3e-15 ref|XP_010258523.1| PREDICTED: electron transfer flavoprotein-ub... 82 3e-15 ref|XP_021752584.1| electron transfer flavoprotein-ubiquinone ox... 81 5e-15 ref|XP_011091641.1| electron transfer flavoprotein-ubiquinone ox... 81 5e-15 ref|XP_020553111.1| electron transfer flavoprotein-ubiquinone ox... 81 5e-15 dbj|GAV64316.1| ETF_QO domain-containing protein/NAD_binding_8 d... 81 5e-15 >gb|POO03613.1| hypothetical protein TorRG33x02_008180 [Trema orientalis] Length = 68 Score = 77.4 bits (189), Expect = 4e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +1 Query: 1 PTSEPFSTTQTDRSVSFSLHSCFSRIAAESPAGPAPTITTS*SMDS 138 PTS PFSTTQTD+S SFS HSCF+R+AA+ PAGPAPTITTS S+DS Sbjct: 13 PTSAPFSTTQTDKSTSFSRHSCFNRMAADKPAGPAPTITTSYSIDS 58 >gb|PNX64922.1| electron transfer flavoprotein-ubiquinone oxidoreductase mitochondrial-like [Trifolium pratense] Length = 141 Score = 79.3 bits (194), Expect = 5e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I YDVVIVGAGPAGLSAAIRLKQLCR+ DTDLSVCV+EKG+EV Sbjct: 39 IQYDVVIVGAGPAGLSAAIRLKQLCRQNDTDLSVCVLEKGAEV 81 >gb|PON63957.1| hypothetical protein PanWU01x14_127240 [Parasponia andersonii] Length = 113 Score = 77.4 bits (189), Expect = 1e-15 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +1 Query: 1 PTSEPFSTTQTDRSVSFSLHSCFSRIAAESPAGPAPTITTS*SMDS 138 PTS PFSTTQTD+S SFS HSCF+R+AA+ PAGPAPTITTS S+DS Sbjct: 13 PTSAPFSTTQTDKSTSFSRHSCFNRMAADKPAGPAPTITTSYSIDS 58 >ref|XP_013465448.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] gb|KEH39483.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] Length = 450 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCRE DTDLSVCV+EKGSEV Sbjct: 56 IEYDVVIVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEV 98 >ref|XP_021906835.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2 [Carica papaya] Length = 478 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 115 IEYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 157 >ref|XP_013465446.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] gb|KEH39481.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] Length = 507 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCRE DTDLSVCV+EKGSEV Sbjct: 56 IEYDVVIVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEV 98 >ref|XP_021906834.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1 [Carica papaya] Length = 509 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 115 IEYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 157 >ref|XP_013465447.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] gb|KEH39482.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] Length = 513 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCRE DTDLSVCV+EKGSEV Sbjct: 56 IEYDVVIVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEV 98 >ref|XP_003597528.2| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] gb|AES67779.2| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago truncatula] Length = 542 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCRE DTDLSVCV+EKGSEV Sbjct: 56 IEYDVVIVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEV 98 >gb|POO03611.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Trema orientalis] Length = 662 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 127 IEYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 169 >gb|PON63954.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Parasponia andersonii] Length = 662 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 127 IEYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 169 >ref|XP_013686185.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Brassica napus] Length = 631 Score = 82.0 bits (201), Expect = 3e-15 Identities = 55/136 (40%), Positives = 75/136 (55%), Gaps = 14/136 (10%) Frame = -2 Query: 368 HS*SINQSINHQAMIRLLSRSLTPLKNS---------ISKHSQTTPSPIVVSKPNPWDFV 216 H ++ +I H+ +++L S S PL+NS ++ + +P P NP+ Sbjct: 11 HHRPLSFTIMHRFLLKLSSSSTNPLRNSKFQRLILPSLNLFASGSPPP---PSANPYS-- 65 Query: 215 GSVSDWFR-----CXXXXXXXXXXXXXXXXXXSIDYDVVIVGAGPAGLSAAIRLKQLCRE 51 +D FR +I+YDVVI+GAGPAGLSAAIRLKQLC+E Sbjct: 66 ---ADSFRKSRAFSSKSRALGVRCISSEAGREAIEYDVVIIGAGPAGLSAAIRLKQLCQE 122 Query: 50 KDTDLSVCVVEKGSEV 3 K+TDLSVCVVEKG+EV Sbjct: 123 KNTDLSVCVVEKGAEV 138 >dbj|GAV87292.1| FAD_binding_2 domain-containing protein, partial [Cephalotus follicularis] Length = 253 Score = 79.7 bits (195), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQ+CRE+D DLSVCVVEKG+EV Sbjct: 159 IEYDVVIVGAGPAGLSAAIRLKQMCREEDIDLSVCVVEKGAEV 201 >ref|XP_008222598.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial [Prunus mume] Length = 657 Score = 81.6 bits (200), Expect = 3e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 123 IQYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 165 >ref|XP_007226965.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1 [Prunus persica] gb|ONI29415.1| hypothetical protein PRUPE_1G197500 [Prunus persica] Length = 658 Score = 81.6 bits (200), Expect = 3e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 123 IQYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 165 >ref|XP_010258523.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1 [Nelumbo nucifera] Length = 661 Score = 81.6 bits (200), Expect = 3e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQLCREKD DLS+CVVEKG+EV Sbjct: 126 INYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSICVVEKGAEV 168 >ref|XP_021752584.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Chenopodium quinoa] Length = 642 Score = 81.3 bits (199), Expect = 5e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 ++YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 107 MEYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 149 >ref|XP_011091641.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X2 [Sesamum indicum] Length = 645 Score = 81.3 bits (199), Expect = 5e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 ++YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 110 LNYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 152 >ref|XP_020553111.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial isoform X1 [Sesamum indicum] Length = 651 Score = 81.3 bits (199), Expect = 5e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 ++YDVVIVGAGPAGLSAAIRLKQLCREKD DLSVCVVEKG+EV Sbjct: 110 LNYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEV 152 >dbj|GAV64316.1| ETF_QO domain-containing protein/NAD_binding_8 domain-containing protein, partial [Cephalotus follicularis] Length = 713 Score = 81.3 bits (199), Expect = 5e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 IDYDVVIVGAGPAGLSAAIRLKQLCREKDTDLSVCVVEKGSEV 3 I+YDVVIVGAGPAGLSAAIRLKQ+CREKD DLSVCVVEKG+EV Sbjct: 177 IEYDVVIVGAGPAGLSAAIRLKQMCREKDIDLSVCVVEKGAEV 219