BLASTX nr result
ID: Ophiopogon23_contig00014669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00014669 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244520.1| uncharacterized protein LOC109822702 [Aspara... 63 5e-10 >ref|XP_020244520.1| uncharacterized protein LOC109822702 [Asparagus officinalis] gb|ONK60525.1| uncharacterized protein A4U43_C08F19430 [Asparagus officinalis] Length = 111 Score = 63.2 bits (152), Expect = 5e-10 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 454 DIFQPLGNGRVSTSSTPCIKCQSKGRIQCPDCSKRP 347 D+FQ LG+GR STSS+PCIKCQS+GRI CPDCS P Sbjct: 76 DLFQSLGDGRDSTSSSPCIKCQSQGRILCPDCSNLP 111