BLASTX nr result
ID: Ophiopogon23_contig00014045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00014045 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259759.1| serine/threonine-protein phosphatase 6 regul... 60 6e-08 ref|XP_020259758.1| serine/threonine-protein phosphatase 6 regul... 60 6e-08 >ref|XP_020259759.1| serine/threonine-protein phosphatase 6 regulatory subunit 3-like isoform X2 [Asparagus officinalis] gb|ONK70694.1| uncharacterized protein A4U43_C04F550 [Asparagus officinalis] Length = 765 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 KSTITKSLEMEIPGEGKPGRMEFNKNHWRAEPEVGVVQE 118 KS+ S E+E+ GE KP MEFNKNHWRAEPEVGVVQE Sbjct: 727 KSSNPNSHEIELHGEDKPAMMEFNKNHWRAEPEVGVVQE 765 >ref|XP_020259758.1| serine/threonine-protein phosphatase 6 regulatory subunit 3-like isoform X1 [Asparagus officinalis] Length = 790 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 2 KSTITKSLEMEIPGEGKPGRMEFNKNHWRAEPEVGVVQE 118 KS+ S E+E+ GE KP MEFNKNHWRAEPEVGVVQE Sbjct: 752 KSSNPNSHEIELHGEDKPAMMEFNKNHWRAEPEVGVVQE 790