BLASTX nr result
ID: Ophiopogon23_contig00011251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00011251 (649 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257782.1| probable ribonuclease P/MRP protein subunit ... 115 7e-29 gb|PIM97184.1| Ribonuclease P [Handroanthus impetiginosus] 93 7e-21 ref|XP_020097772.1| probable ribonuclease P/MRP protein subunit ... 94 1e-20 gb|OAY75803.1| putative ribonuclease P/MRP protein subunit POP5,... 94 1e-20 gb|PIN08657.1| RNase P/RNase MRP subunit POP5 [Handroanthus impe... 93 3e-20 ref|XP_011075849.1| probable ribonuclease P/MRP protein subunit ... 93 3e-20 ref|XP_008791685.1| PREDICTED: probable ribonuclease P/MRP prote... 93 3e-20 ref|XP_020524186.1| probable ribonuclease P/MRP protein subunit ... 92 4e-20 gb|OMO71015.1| Ribonuclease P/MRP protein subunit [Corchorus cap... 92 7e-20 gb|KCW46136.1| hypothetical protein EUGRSUZ_K00059 [Eucalyptus g... 92 7e-20 gb|OMO88614.1| Ribonuclease P/MRP protein subunit [Corchorus oli... 92 9e-20 gb|EEF49209.1| lipoate-protein ligase B, putative [Ricinus commu... 91 1e-19 gb|KCW46130.1| hypothetical protein EUGRSUZ_K00052 [Eucalyptus g... 92 1e-19 ref|NP_001142473.1| uncharacterized protein LOC100274684 [Zea ma... 91 1e-19 ref|XP_002513218.2| PREDICTED: probable ribonuclease P/MRP prote... 91 1e-19 ref|XP_010035335.1| PREDICTED: probable ribonuclease P/MRP prote... 91 1e-19 gb|OEL23004.1| putative ribonuclease P/MRP protein subunit POP5 ... 91 2e-19 ref|XP_010919449.1| PREDICTED: probable ribonuclease P/MRP prote... 91 2e-19 ref|XP_021692600.1| probable ribonuclease P/MRP protein subunit ... 91 2e-19 ref|XP_012843722.1| PREDICTED: probable ribonuclease P/MRP prote... 90 3e-19 >ref|XP_020257782.1| probable ribonuclease P/MRP protein subunit POP5 isoform X1 [Asparagus officinalis] ref|XP_020257783.1| probable ribonuclease P/MRP protein subunit POP5 isoform X2 [Asparagus officinalis] ref|XP_020257784.1| probable ribonuclease P/MRP protein subunit POP5 isoform X1 [Asparagus officinalis] ref|XP_020257785.1| probable ribonuclease P/MRP protein subunit POP5 isoform X1 [Asparagus officinalis] gb|ONK75964.1| uncharacterized protein A4U43_C03F22410 [Asparagus officinalis] Length = 153 Score = 115 bits (287), Expect = 7e-29 Identities = 56/71 (78%), Positives = 60/71 (84%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIGNC VT NLLDLSGSIKACKRSALKCDEAKFEQYKLE GG +PP+ S VE Sbjct: 83 SAITMVRSIGNCSVTLNLLDLSGSIKACKRSALKCDEAKFEQYKLEVGGFVPPETCSLVE 142 Query: 454 KCFQKIKFLES 486 KCFQKIKFLES Sbjct: 143 KCFQKIKFLES 153 >gb|PIM97184.1| Ribonuclease P [Handroanthus impetiginosus] Length = 100 Score = 92.8 bits (229), Expect = 7e-21 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 S+GNCPV FNLLDLSGSIKACKR+ALKCD KFEQYKL AG +P D ++ C +KIK Sbjct: 37 SVGNCPVVFNLLDLSGSIKACKRAALKCDGLKFEQYKLAAGDQLPADMEQRMQNCLEKIK 96 Query: 475 FLE 483 LE Sbjct: 97 VLE 99 >ref|XP_020097772.1| probable ribonuclease P/MRP protein subunit POP5 [Ananas comosus] Length = 154 Score = 94.0 bits (232), Expect = 1e-20 Identities = 45/70 (64%), Positives = 54/70 (77%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIG CPV+FNLLDLSGSIKACKR+AL CDEAKFEQY+L AG + P+ V+ Sbjct: 84 SAITMVRSIGKCPVSFNLLDLSGSIKACKRAALMCDEAKFEQYRLAAGDLVTPEITDVVK 143 Query: 454 KCFQKIKFLE 483 CF+KIK LE Sbjct: 144 SCFEKIKALE 153 >gb|OAY75803.1| putative ribonuclease P/MRP protein subunit POP5, partial [Ananas comosus] Length = 162 Score = 94.0 bits (232), Expect = 1e-20 Identities = 45/70 (64%), Positives = 53/70 (75%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S L + SIG CPV+FNLLDLSGSIK CKR+AL CDEAKFEQY+L AG + P+ V+ Sbjct: 92 SALTMVRSIGKCPVSFNLLDLSGSIKGCKRAALVCDEAKFEQYRLAAGDRVTPEITDVVK 151 Query: 454 KCFQKIKFLE 483 CF+KIK LE Sbjct: 152 SCFEKIKALE 161 >gb|PIN08657.1| RNase P/RNase MRP subunit POP5 [Handroanthus impetiginosus] Length = 154 Score = 92.8 bits (229), Expect = 3e-20 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 S+GNCPV FNLLDLSGSIKACKR+ALKCD KFEQYKL AG +P D ++ C +KIK Sbjct: 91 SVGNCPVVFNLLDLSGSIKACKRAALKCDGLKFEQYKLAAGDQLPADMEQRMQNCLEKIK 150 Query: 475 FLE 483 LE Sbjct: 151 VLE 153 >ref|XP_011075849.1| probable ribonuclease P/MRP protein subunit POP5 [Sesamum indicum] Length = 154 Score = 92.8 bits (229), Expect = 3e-20 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 SIGNCPV FNLLDLSGSIKACK++ALKCDE+KFEQ+KL AG +P D ++ C +KIK Sbjct: 91 SIGNCPVVFNLLDLSGSIKACKQAALKCDESKFEQHKLLAGERLPADAHQRMQNCIEKIK 150 Query: 475 FLE 483 LE Sbjct: 151 ALE 153 >ref|XP_008791685.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Phoenix dactylifera] ref|XP_008791686.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Phoenix dactylifera] ref|XP_008791688.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Phoenix dactylifera] Length = 154 Score = 92.8 bits (229), Expect = 3e-20 Identities = 46/71 (64%), Positives = 55/71 (77%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIG CPVTFNLL+LSGSIKACKR+ALKCDEAKFEQYKL AG + P+ V+ Sbjct: 84 SAITMVRSIGKCPVTFNLLNLSGSIKACKRAALKCDEAKFEQYKLTAGDRVTPEITHYVK 143 Query: 454 KCFQKIKFLES 486 F+KIK LE+ Sbjct: 144 GRFEKIKTLEN 154 >ref|XP_020524186.1| probable ribonuclease P/MRP protein subunit POP5 isoform X13 [Amborella trichopoda] Length = 154 Score = 92.4 bits (228), Expect = 4e-20 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 +IGNCPV FNLL+LSG I+ACKR ALKCDEAKFE YKL G N+ P + V+ CF+KIK Sbjct: 91 NIGNCPVIFNLLNLSGCIRACKREALKCDEAKFELYKLTVGDNLSPQVLQQVQNCFEKIK 150 Query: 475 FLE 483 LE Sbjct: 151 VLE 153 >gb|OMO71015.1| Ribonuclease P/MRP protein subunit [Corchorus capsularis] Length = 144 Score = 91.7 bits (226), Expect = 7e-20 Identities = 43/70 (61%), Positives = 50/70 (71%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIGNCPV FNLLDLSGSIKACK +ALKCDE KFEQYKL G + D ++ Sbjct: 74 SAITMVRSIGNCPVLFNLLDLSGSIKACKNAALKCDELKFEQYKLMVGARLSADVTQQMQ 133 Query: 454 KCFQKIKFLE 483 C +KIK LE Sbjct: 134 NCLEKIKILE 143 >gb|KCW46136.1| hypothetical protein EUGRSUZ_K00059 [Eucalyptus grandis] Length = 159 Score = 92.0 bits (227), Expect = 7e-20 Identities = 42/61 (68%), Positives = 49/61 (80%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 SIGNCPV FNLLDLSGSIKACK++ALKCDE KFEQYKL +G + P+ I + C +KIK Sbjct: 81 SIGNCPVLFNLLDLSGSIKACKKAALKCDELKFEQYKLVSGSRLSPEVIQQMHNCQEKIK 140 Query: 475 F 477 F Sbjct: 141 F 141 >gb|OMO88614.1| Ribonuclease P/MRP protein subunit [Corchorus olitorius] Length = 154 Score = 91.7 bits (226), Expect = 9e-20 Identities = 43/70 (61%), Positives = 50/70 (71%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIGNCPV FNLLDLSGSIKACK +ALKCDE KFEQYKL G + D ++ Sbjct: 84 SAITMVRSIGNCPVLFNLLDLSGSIKACKNAALKCDELKFEQYKLMVGARLSADVTQQMQ 143 Query: 454 KCFQKIKFLE 483 C +KIK LE Sbjct: 144 NCLEKIKILE 153 >gb|EEF49209.1| lipoate-protein ligase B, putative [Ricinus communis] Length = 144 Score = 91.3 bits (225), Expect = 1e-19 Identities = 43/70 (61%), Positives = 53/70 (75%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIGNCPV FNLLDLSGSI+ACKR+ALKCDEAKFEQ+KL G ++ D ++ Sbjct: 74 SAVTMVRSIGNCPVLFNLLDLSGSIRACKRAALKCDEAKFEQHKLAVGDHLSADVTLHMQ 133 Query: 454 KCFQKIKFLE 483 C +KIK LE Sbjct: 134 NCLEKIKILE 143 >gb|KCW46130.1| hypothetical protein EUGRSUZ_K00052 [Eucalyptus grandis] Length = 158 Score = 91.7 bits (226), Expect = 1e-19 Identities = 41/61 (67%), Positives = 49/61 (80%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 S+GNCPV FNLLDLSGSIKACK++ALKCDE KFEQYKL +G + P+ I + C +KIK Sbjct: 81 SVGNCPVLFNLLDLSGSIKACKKAALKCDELKFEQYKLVSGSRLSPEVIQQMHNCQEKIK 140 Query: 475 F 477 F Sbjct: 141 F 141 >ref|NP_001142473.1| uncharacterized protein LOC100274684 [Zea mays] gb|ACG24217.1| hypothetical protein [Zea mays] Length = 152 Score = 91.3 bits (225), Expect = 1e-19 Identities = 44/63 (69%), Positives = 53/63 (84%) Frame = +1 Query: 298 IGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIKF 477 IG PV+FNLLD+SGSI+ACK++AL+CDEAKFEQYKL AG I + I SVEKCF+KI+ Sbjct: 90 IGKIPVSFNLLDMSGSIRACKKAALECDEAKFEQYKLAAGDCITAEIIQSVEKCFEKIRG 149 Query: 478 LES 486 LES Sbjct: 150 LES 152 >ref|XP_002513218.2| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Ricinus communis] Length = 154 Score = 91.3 bits (225), Expect = 1e-19 Identities = 43/70 (61%), Positives = 53/70 (75%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIGNCPV FNLLDLSGSI+ACKR+ALKCDEAKFEQ+KL G ++ D ++ Sbjct: 84 SAVTMVRSIGNCPVLFNLLDLSGSIRACKRAALKCDEAKFEQHKLAVGDHLSADVTLHMQ 143 Query: 454 KCFQKIKFLE 483 C +KIK LE Sbjct: 144 NCLEKIKILE 153 >ref|XP_010035335.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Eucalyptus grandis] ref|XP_018720800.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Eucalyptus grandis] gb|KCW46671.1| hypothetical protein EUGRSUZ_K00477 [Eucalyptus grandis] Length = 154 Score = 91.3 bits (225), Expect = 1e-19 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 S+GNCPV FNLLDLSGSIKACK++ALKCDE KFEQYKL +G + P+ + + C +KIK Sbjct: 91 SVGNCPVLFNLLDLSGSIKACKKAALKCDELKFEQYKLVSGSRLSPEVVQQMHNCQEKIK 150 Query: 475 FLE 483 L+ Sbjct: 151 ILD 153 >gb|OEL23004.1| putative ribonuclease P/MRP protein subunit POP5 [Dichanthelium oligosanthes] Length = 152 Score = 90.9 bits (224), Expect = 2e-19 Identities = 41/63 (65%), Positives = 53/63 (84%) Frame = +1 Query: 298 IGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIKF 477 IG PV+FNLLD+SGSI+ACK++AL+CDEAKFEQYK+ AG + P+ I SV+ CF+KI+ Sbjct: 90 IGKIPVSFNLLDMSGSIRACKKAALECDEAKFEQYKVAAGDRVTPEIIQSVQSCFEKIRG 149 Query: 478 LES 486 LES Sbjct: 150 LES 152 >ref|XP_010919449.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Elaeis guineensis] ref|XP_010919450.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Elaeis guineensis] Length = 154 Score = 90.9 bits (224), Expect = 2e-19 Identities = 45/71 (63%), Positives = 54/71 (76%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIG CPVTFNLL+LSG+IKACKR+ALKCDEAKFEQYKL AG + P+ V+ Sbjct: 84 SAITMVRSIGKCPVTFNLLNLSGTIKACKRAALKCDEAKFEQYKLAAGDRVTPEITRYVK 143 Query: 454 KCFQKIKFLES 486 F KIK LE+ Sbjct: 144 GRFDKIKTLEN 154 >ref|XP_021692600.1| probable ribonuclease P/MRP protein subunit POP5 [Hevea brasiliensis] ref|XP_021652861.1| probable ribonuclease P/MRP protein subunit POP5 isoform X1 [Hevea brasiliensis] ref|XP_021652862.1| probable ribonuclease P/MRP protein subunit POP5 isoform X2 [Hevea brasiliensis] ref|XP_021652863.1| probable ribonuclease P/MRP protein subunit POP5 isoform X1 [Hevea brasiliensis] ref|XP_021652864.1| probable ribonuclease P/MRP protein subunit POP5 isoform X1 [Hevea brasiliensis] ref|XP_021652865.1| probable ribonuclease P/MRP protein subunit POP5 isoform X2 [Hevea brasiliensis] ref|XP_021652866.1| probable ribonuclease P/MRP protein subunit POP5 isoform X2 [Hevea brasiliensis] Length = 154 Score = 90.5 bits (223), Expect = 2e-19 Identities = 43/70 (61%), Positives = 50/70 (71%) Frame = +1 Query: 274 SMLLVAGSIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVE 453 S + + SIGNCPV FNLLDLSGSIKACK +ALKCDE KFEQYKL G + D ++ Sbjct: 84 SAITMVRSIGNCPVLFNLLDLSGSIKACKSAALKCDELKFEQYKLVVGDRLSEDVTKHMQ 143 Query: 454 KCFQKIKFLE 483 C +KIK LE Sbjct: 144 NCLEKIKILE 153 >ref|XP_012843722.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Erythranthe guttata] gb|EYU45343.1| hypothetical protein MIMGU_mgv1a015535mg [Erythranthe guttata] Length = 154 Score = 90.1 bits (222), Expect = 3e-19 Identities = 41/64 (64%), Positives = 51/64 (79%) Frame = +1 Query: 295 SIGNCPVTFNLLDLSGSIKACKRSALKCDEAKFEQYKLEAGGNIPPDGISSVEKCFQKIK 474 SIGNCPV FNLLDLSGSI+ACK +ALKCDE+K+EQYK+ AG + PD ++ C +KIK Sbjct: 91 SIGNCPVVFNLLDLSGSIRACKIAALKCDESKYEQYKILAGDRLSPDTNQRMQNCLEKIK 150 Query: 475 FLES 486 LE+ Sbjct: 151 TLEN 154