BLASTX nr result
ID: Ophiopogon23_contig00010031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00010031 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251917.1| uncharacterized protein LOC109829181 [Aspara... 77 8e-14 >ref|XP_020251917.1| uncharacterized protein LOC109829181 [Asparagus officinalis] Length = 218 Score = 77.0 bits (188), Expect = 8e-14 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +1 Query: 361 ADSGLSEGEESREMPNMGTVIETSVADAHATAPLLERRASVWNCCGLLDFFKGSE 525 ADS +SEGEE EMP MGTVIET + P+LE+RAS+WNCCGLLD FKGS+ Sbjct: 164 ADSAVSEGEERGEMPIMGTVIETPETAGQSHFPILEQRASLWNCCGLLDLFKGSQ 218