BLASTX nr result
ID: Ophiopogon23_contig00009230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00009230 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020574375.1| LOW QUALITY PROTEIN: dolichyl-phosphate beta... 93 2e-19 ref|XP_020694753.1| dolichyl-phosphate beta-glucosyltransferase ... 91 1e-18 gb|ONK78373.1| uncharacterized protein A4U43_C02F18100 [Asparagu... 89 1e-18 ref|XP_020252513.1| dolichyl-phosphate beta-glucosyltransferase-... 91 1e-18 ref|XP_020242153.1| dolichyl-phosphate beta-glucosyltransferase-... 91 1e-18 ref|XP_009420096.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 91 1e-18 gb|PKA63148.1| dolichyl-phosphate beta-glucosyltransferase [Apos... 91 2e-18 ref|XP_008802745.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 88 7e-18 ref|XP_008802744.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 88 1e-17 ref|XP_010931260.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 88 1e-17 ref|XP_008776809.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 87 3e-17 ref|XP_008776804.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 87 3e-17 gb|PAN44266.1| hypothetical protein PAHAL_I01253 [Panicum hallii] 86 3e-17 ref|XP_004981245.1| dolichyl-phosphate beta-glucosyltransferase ... 87 4e-17 ref|XP_020100699.1| dolichyl-phosphate beta-glucosyltransferase ... 87 4e-17 gb|PAN44265.1| hypothetical protein PAHAL_I01253 [Panicum hallii] 86 1e-16 ref|XP_006846167.1| dolichyl-phosphate beta-glucosyltransferase ... 85 1e-16 gb|KMZ75125.1| dolichyl-phosphate beta-D-mannosyltransferase, fa... 84 2e-16 ref|XP_020523993.1| dolichyl-phosphate beta-glucosyltransferase ... 85 2e-16 ref|XP_021307192.1| dolichyl-phosphate beta-glucosyltransferase ... 85 2e-16 >ref|XP_020574375.1| LOW QUALITY PROTEIN: dolichyl-phosphate beta-glucosyltransferase [Phalaenopsis equestris] Length = 346 Score = 93.2 bits (230), Expect = 2e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 NIPM+EVSVNWSEIPGSKV LTSI HMLFEL+LIRLGYGLGIWKIYT Sbjct: 300 NIPMIEVSVNWSEIPGSKVRLTSIAHMLFELILIRLGYGLGIWKIYT 346 >ref|XP_020694753.1| dolichyl-phosphate beta-glucosyltransferase isoform X1 [Dendrobium catenatum] gb|PKU68890.1| dolichyl-phosphate beta-glucosyltransferase [Dendrobium catenatum] Length = 346 Score = 90.9 bits (224), Expect = 1e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 NIPM+EVSVNW+EIPGSKV LTSI HMLFEL LIRLGYGLGIWKIYT Sbjct: 300 NIPMIEVSVNWTEIPGSKVRLTSIAHMLFELTLIRLGYGLGIWKIYT 346 >gb|ONK78373.1| uncharacterized protein A4U43_C02F18100 [Asparagus officinalis] Length = 237 Score = 89.0 bits (219), Expect = 1e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPM+EVSVNWSEIPGSKV LTS+VHMLFELV+IRLGYGL IWKIYT Sbjct: 192 IPMIEVSVNWSEIPGSKVRLTSVVHMLFELVVIRLGYGLSIWKIYT 237 >ref|XP_020252513.1| dolichyl-phosphate beta-glucosyltransferase-like [Asparagus officinalis] Length = 359 Score = 90.9 bits (224), Expect = 1e-18 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPM+EVSVNWSEIPGSKV LTSIVHMLFELVLIRLGYGLGIWKI+T Sbjct: 314 IPMIEVSVNWSEIPGSKVRLTSIVHMLFELVLIRLGYGLGIWKIHT 359 >ref|XP_020242153.1| dolichyl-phosphate beta-glucosyltransferase-like [Asparagus officinalis] Length = 361 Score = 90.9 bits (224), Expect = 1e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 NIPM+EVSVNW EIPGSKV LTSI+HMLFEL+LIRLGYGLGIWKIYT Sbjct: 315 NIPMMEVSVNWCEIPGSKVRLTSIIHMLFELLLIRLGYGLGIWKIYT 361 >ref|XP_009420096.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Musa acuminata subsp. malaccensis] Length = 338 Score = 90.5 bits (223), Expect = 1e-18 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 +IPM+EVSVNWSEIPGSKV LTSI+HMLFEL+LIRLGYGLGIWKI+T Sbjct: 292 SIPMIEVSVNWSEIPGSKVRLTSIIHMLFELILIRLGYGLGIWKIHT 338 >gb|PKA63148.1| dolichyl-phosphate beta-glucosyltransferase [Apostasia shenzhenica] Length = 358 Score = 90.5 bits (223), Expect = 2e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 NIPM EVSVNW+EIPGSKV LTSI+HMLFEL+LIRLGYGLGIWKIYT Sbjct: 312 NIPMSEVSVNWAEIPGSKVRLTSILHMLFELILIRLGYGLGIWKIYT 358 >ref|XP_008802745.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Phoenix dactylifera] Length = 301 Score = 88.2 bits (217), Expect = 7e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPM+EVSV WSEIPGSKV +TSI+HMLFEL+LIRLGYGLGIWKIYT Sbjct: 256 IPMIEVSVTWSEIPGSKVRMTSIMHMLFELILIRLGYGLGIWKIYT 301 >ref|XP_008802744.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Phoenix dactylifera] Length = 346 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPM+EVSV WSEIPGSKV +TSI+HMLFEL+LIRLGYGLGIWKIYT Sbjct: 301 IPMIEVSVTWSEIPGSKVRMTSIMHMLFELILIRLGYGLGIWKIYT 346 >ref|XP_010931260.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Elaeis guineensis] Length = 347 Score = 88.2 bits (217), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSV WSEIPGSKV LTSI+HMLFEL+LIRLGYGLGIWKI+T Sbjct: 302 IPMVEVSVTWSEIPGSKVRLTSIIHMLFELILIRLGYGLGIWKIHT 347 >ref|XP_008776809.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Phoenix dactylifera] Length = 353 Score = 87.0 bits (214), Expect = 3e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSV WSEIPGSKV LTSI+HMLFEL+LIR+GYGLGIWKI+T Sbjct: 308 IPMVEVSVTWSEIPGSKVRLTSIIHMLFELILIRVGYGLGIWKIHT 353 >ref|XP_008776804.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Phoenix dactylifera] Length = 363 Score = 87.0 bits (214), Expect = 3e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSV WSEIPGSKV LTSI+HMLFEL+LIR+GYGLGIWKI+T Sbjct: 318 IPMVEVSVTWSEIPGSKVRLTSIIHMLFELILIRVGYGLGIWKIHT 363 >gb|PAN44266.1| hypothetical protein PAHAL_I01253 [Panicum hallii] Length = 256 Score = 85.5 bits (210), Expect = 3e-17 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSVNW+EIPGSKV +TSI+HM+FEL+LI++GYGLGIWKIYT Sbjct: 211 IPMVEVSVNWTEIPGSKVRMTSIMHMVFELLLIKVGYGLGIWKIYT 256 >ref|XP_004981245.1| dolichyl-phosphate beta-glucosyltransferase [Setaria italica] gb|KQK86422.1| hypothetical protein SETIT_036396mg [Setaria italica] Length = 351 Score = 86.7 bits (213), Expect = 4e-17 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSVNW+EIPGSKV +TSI+HM+FEL+LIR+GYGLGIWKIYT Sbjct: 306 IPMVEVSVNWTEIPGSKVRMTSIMHMVFELLLIRVGYGLGIWKIYT 351 >ref|XP_020100699.1| dolichyl-phosphate beta-glucosyltransferase [Ananas comosus] gb|OAY83457.1| Dolichyl-phosphate beta-glucosyltransferase [Ananas comosus] Length = 353 Score = 86.7 bits (213), Expect = 4e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPM+E+SVNWSEIPGSKV LTSI HMLFEL+LIR+GYGLGIWKI+T Sbjct: 308 IPMLEISVNWSEIPGSKVRLTSIAHMLFELILIRVGYGLGIWKIHT 353 >gb|PAN44265.1| hypothetical protein PAHAL_I01253 [Panicum hallii] Length = 351 Score = 85.5 bits (210), Expect = 1e-16 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSVNW+EIPGSKV +TSI+HM+FEL+LI++GYGLGIWKIYT Sbjct: 306 IPMVEVSVNWTEIPGSKVRMTSIMHMVFELLLIKVGYGLGIWKIYT 351 >ref|XP_006846167.1| dolichyl-phosphate beta-glucosyltransferase isoform X2 [Amborella trichopoda] gb|ERN07842.1| hypothetical protein AMTR_s00012p00197190 [Amborella trichopoda] Length = 339 Score = 85.1 bits (209), Expect = 1e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKI 136 NIPM+E+SVNWSEIPGSKV +TSI+HMLFEL+LIR GYGLGIWKI Sbjct: 293 NIPMIEISVNWSEIPGSKVRMTSILHMLFELLLIRTGYGLGIWKI 337 >gb|KMZ75125.1| dolichyl-phosphate beta-D-mannosyltransferase, family GT2 [Zostera marina] Length = 303 Score = 84.3 bits (207), Expect = 2e-16 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 NIP+VEVSVNWSEIPGSK+ + SI+HMLFE++LIRLGY LG+WKIYT Sbjct: 257 NIPIVEVSVNWSEIPGSKIRMISIMHMLFEMLLIRLGYSLGLWKIYT 303 >ref|XP_020523993.1| dolichyl-phosphate beta-glucosyltransferase isoform X1 [Amborella trichopoda] Length = 372 Score = 85.1 bits (209), Expect = 2e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 2 NIPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKI 136 NIPM+E+SVNWSEIPGSKV +TSI+HMLFEL+LIR GYGLGIWKI Sbjct: 326 NIPMIEISVNWSEIPGSKVRMTSILHMLFELLLIRTGYGLGIWKI 370 >ref|XP_021307192.1| dolichyl-phosphate beta-glucosyltransferase [Sorghum bicolor] Length = 350 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = +2 Query: 5 IPMVEVSVNWSEIPGSKVGLTSIVHMLFELVLIRLGYGLGIWKIYT 142 IPMVEVSVNW+EIPGSKV +TSI+HM+FEL+LI++GYGLGIWKIY+ Sbjct: 305 IPMVEVSVNWTEIPGSKVRMTSIIHMVFELLLIKVGYGLGIWKIYS 350