BLASTX nr result
ID: Ophiopogon23_contig00008330
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00008330 (1104 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodiu... 91 3e-19 gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 82 8e-16 gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium... 69 1e-11 >gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodium distachyon] Length = 59 Score = 90.5 bits (223), Expect = 3e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -1 Query: 1002 MERVAGIEPASLAWKARGYSRR*LIIFNVSNSKPNMKFWFHSAPLW 865 MERVAGIEPASLAWKARGYSRR LII+NVSNSKPNMKF FHSAPLW Sbjct: 1 MERVAGIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLW 46 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -1 Query: 999 ERVAGIEPASLAWKARGYSRR*LIIFNVSNSKPNMKFWFHSAPLWR 862 +RVAGIEPASLAWKA+GYSRR +VSNSKPNMK WFHSAPLWR Sbjct: 12 KRVAGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 69.3 bits (168), Expect = 1e-11 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -1 Query: 1032 QTDDTCRIRNMERVAGIEPASLAWKARGYSRR*LIIFNVSNSKPNMKF 889 QT+ + MERV GIEP LAWKARGYS R LIIFNVSNSKPNMKF Sbjct: 4 QTNRIVFLYKMERVVGIEPTLLAWKARGYSGRWLIIFNVSNSKPNMKF 51