BLASTX nr result
ID: Ophiopogon23_contig00006328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006328 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267108.1| ubiquitin-conjugating enzyme E2 32 [Asparagu... 73 1e-12 >ref|XP_020267108.1| ubiquitin-conjugating enzyme E2 32 [Asparagus officinalis] gb|ONK67593.1| uncharacterized protein A4U43_C05F1700 [Asparagus officinalis] Length = 303 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 409 QQQPKSDRLFSVAALGLAVAIAFLLVKKYLKSQGLPGFMEGM 284 QQQPKSDRLFSVAA GLAVAI LLVKKY+KS G+PGFMEG+ Sbjct: 262 QQQPKSDRLFSVAAFGLAVAIVILLVKKYVKSHGIPGFMEGL 303