BLASTX nr result
ID: Ophiopogon23_contig00006309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006309 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010044552.1| PREDICTED: probable leucine-rich repeat rece... 68 7e-11 ref|XP_018830426.1| PREDICTED: probable leucine-rich repeat rece... 67 2e-10 ref|XP_018830424.1| PREDICTED: probable leucine-rich repeat rece... 67 2e-10 ref|XP_018830420.1| PREDICTED: probable leucine-rich repeat rece... 67 2e-10 ref|XP_010067427.2| PREDICTED: probable leucine-rich repeat rece... 66 5e-10 ref|XP_020254379.1| probable leucine-rich repeat receptor-like p... 65 1e-09 ref|XP_020254380.1| probable leucine-rich repeat receptor-like p... 65 1e-09 gb|KCW88501.1| hypothetical protein EUGRSUZ_A00887 [Eucalyptus g... 64 3e-09 ref|XP_010044534.1| PREDICTED: probable leucine-rich repeat rece... 64 3e-09 ref|XP_010044526.1| PREDICTED: probable leucine-rich repeat rece... 64 3e-09 ref|XP_008782792.1| PREDICTED: probable leucine-rich repeat rece... 63 4e-09 ref|XP_020175887.1| probable leucine-rich repeat receptor-like p... 61 2e-08 gb|PKI44600.1| hypothetical protein CRG98_034955 [Punica granatum] 61 3e-08 gb|OWM67008.1| hypothetical protein CDL15_Pgr000460 [Punica gran... 61 3e-08 emb|CDP15606.1| unnamed protein product [Coffea canephora] 60 5e-08 emb|CDP08081.1| unnamed protein product [Coffea canephora] 60 5e-08 ref|XP_011018905.1| PREDICTED: probable leucine-rich repeat rece... 60 7e-08 gb|OEL31342.1| putative leucine-rich repeat receptor-like protei... 59 9e-08 ref|XP_015690746.1| PREDICTED: probable leucine-rich repeat rece... 59 1e-07 gb|KCW88500.1| hypothetical protein EUGRSUZ_A00886 [Eucalyptus g... 59 1e-07 >ref|XP_010044552.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Eucalyptus grandis] gb|KCW88499.1| hypothetical protein EUGRSUZ_A00885 [Eucalyptus grandis] Length = 983 Score = 68.2 bits (165), Expect = 7e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 A W+NTPPNWG+S DPCG +PWDGVTCNNNSRV Sbjct: 54 AQWQNTPPNWGKSSDPCG-LPWDGVTCNNNSRV 85 >ref|XP_018830426.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X5 [Juglans regia] Length = 719 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +3 Query: 243 VLNG--ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 VLN A WKNTPP+WG S+DPCG WDGVTCNNNSRV Sbjct: 29 VLNALKAAWKNTPPSWGYSEDPCGLPVWDGVTCNNNSRV 67 >ref|XP_018830424.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X3 [Juglans regia] Length = 795 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +3 Query: 243 VLNG--ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 VLN A WKNTPP+WG S+DPCG WDGVTCNNNSRV Sbjct: 29 VLNALKAAWKNTPPSWGYSEDPCGLPVWDGVTCNNNSRV 67 >ref|XP_018830420.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Juglans regia] Length = 958 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +3 Query: 243 VLNG--ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 VLN A WKNTPP+WG S+DPCG WDGVTCNNNSRV Sbjct: 29 VLNALKAAWKNTPPSWGYSEDPCGLPVWDGVTCNNNSRV 67 >ref|XP_010067427.2| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Eucalyptus grandis] Length = 987 Score = 65.9 bits (159), Expect = 5e-10 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 A W+NTPPNWG+S DPCG +PWDGVTC+NNSRV Sbjct: 60 AQWQNTPPNWGKSGDPCG-LPWDGVTCHNNSRV 91 >ref|XP_020254379.1| probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Asparagus officinalis] Length = 699 Score = 64.7 bits (156), Expect = 1e-09 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 ++W+NTPPNWGQS+DPCG VPW+G+ CNN SRV Sbjct: 37 SEWQNTPPNWGQSNDPCG-VPWEGIVCNNKSRV 68 >ref|XP_020254380.1| probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X2 [Asparagus officinalis] Length = 953 Score = 64.7 bits (156), Expect = 1e-09 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 ++W+NTPPNWGQS+DPCG VPW+G+ CNN SRV Sbjct: 37 SEWQNTPPNWGQSNDPCG-VPWEGIVCNNKSRV 68 >gb|KCW88501.1| hypothetical protein EUGRSUZ_A00887 [Eucalyptus grandis] Length = 904 Score = 63.5 bits (153), Expect = 3e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 A W++TPPNWG+S+DPCG +PWDG+TCN+NSRV Sbjct: 34 AQWQDTPPNWGKSNDPCG-LPWDGLTCNSNSRV 65 >ref|XP_010044534.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X2 [Eucalyptus grandis] Length = 969 Score = 63.5 bits (153), Expect = 3e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 A W++TPPNWG+S+DPCG +PWDG+TCN+NSRV Sbjct: 60 AQWQDTPPNWGKSNDPCG-LPWDGLTCNSNSRV 91 >ref|XP_010044526.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Eucalyptus grandis] Length = 985 Score = 63.5 bits (153), Expect = 3e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 A W++TPPNWG+S+DPCG +PWDG+TCN+NSRV Sbjct: 60 AQWQDTPPNWGKSNDPCG-LPWDGLTCNSNSRV 91 >ref|XP_008782792.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Phoenix dactylifera] Length = 914 Score = 63.2 bits (152), Expect = 4e-09 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 WKNTPPNWGQSDDPCG PW+GVTCNN+ Sbjct: 12 WKNTPPNWGQSDDPCG-TPWEGVTCNNS 38 >ref|XP_020175887.1| probable leucine-rich repeat receptor-like protein kinase At5g49770 [Aegilops tauschii subsp. tauschii] Length = 967 Score = 61.2 bits (147), Expect = 2e-08 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W+N+PP WGQSDDPCG PWDGVTC+N+ Sbjct: 40 WQNSPPTWGQSDDPCGVSPWDGVTCSND 67 >gb|PKI44600.1| hypothetical protein CRG98_034955 [Punica granatum] Length = 955 Score = 60.8 bits (146), Expect = 3e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W NTPPNWG+SDDPCG+ PWDGVTCNN+ Sbjct: 40 WLNTPPNWGRSDDPCGS-PWDGVTCNNS 66 >gb|OWM67008.1| hypothetical protein CDL15_Pgr000460 [Punica granatum] Length = 1185 Score = 60.8 bits (146), Expect = 3e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W NTPPNWG+SDDPCG+ PWDGVTCNN+ Sbjct: 311 WLNTPPNWGRSDDPCGS-PWDGVTCNNS 337 Score = 53.9 bits (128), Expect = 7e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W NTPP+WG+SDDPCG W+G+TCNN+ Sbjct: 40 WLNTPPSWGESDDPCGGF-WEGITCNNS 66 >emb|CDP15606.1| unnamed protein product [Coffea canephora] Length = 949 Score = 60.1 bits (144), Expect = 5e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 W+NTPP+WG+SDDPCG PW+GV+CNN SRV Sbjct: 39 WQNTPPSWGKSDDPCG-FPWEGVSCNNYSRV 68 >emb|CDP08081.1| unnamed protein product [Coffea canephora] Length = 962 Score = 60.1 bits (144), Expect = 5e-08 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W+NTPPNWG+SDDPCGA PW+GV+CNN+ Sbjct: 39 WQNTPPNWGKSDDPCGA-PWEGVSCNNS 65 >ref|XP_011018905.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Populus euphratica] Length = 967 Score = 59.7 bits (143), Expect = 7e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 + W+NTPP+WGQSDDPCGA PW+GVTC+N+ Sbjct: 41 SQWQNTPPSWGQSDDPCGA-PWEGVTCSNS 69 >gb|OEL31342.1| putative leucine-rich repeat receptor-like protein kinase [Dichanthelium oligosanthes] Length = 946 Score = 59.3 bits (142), Expect = 9e-08 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W+N PP WGQSDDPCG PW+GVTC NN Sbjct: 51 WQNAPPTWGQSDDPCGDSPWEGVTCANN 78 >ref|XP_015690746.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Oryza brachyantha] Length = 931 Score = 58.9 bits (141), Expect = 1e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 261 WKNTPPNWGQSDDPCGAVPWDGVTCNNN 344 W+N PP WGQSDDPCG PWDGV C+N+ Sbjct: 4 WQNAPPTWGQSDDPCGDAPWDGVVCSNS 31 >gb|KCW88500.1| hypothetical protein EUGRSUZ_A00886 [Eucalyptus grandis] Length = 975 Score = 58.9 bits (141), Expect = 1e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 255 ADWKNTPPNWGQSDDPCGAVPWDGVTCNNNSRV 353 A W++TPPNWG+S DPCG +PW GVTC++NSRV Sbjct: 60 AQWQDTPPNWGKSSDPCG-LPWVGVTCDSNSRV 91