BLASTX nr result
ID: Ophiopogon23_contig00006304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006304 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75443.1| uncharacterized protein A4U43_C03F16890 [Asparagu... 77 1e-13 ref|XP_020257306.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 77 2e-13 gb|EAY92167.1| hypothetical protein OsI_13880 [Oryza sativa Indi... 71 2e-11 gb|PAN44623.1| hypothetical protein PAHAL_I01197 [Panicum hallii] 70 4e-11 gb|OEL36322.1| Pentatricopeptide repeat-containing protein [Dich... 70 4e-11 gb|EAZ28899.1| hypothetical protein OsJ_12939 [Oryza sativa Japo... 70 4e-11 ref|XP_015632361.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-11 ref|XP_003557509.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-11 ref|XP_006650721.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-11 ref|XP_002466303.1| pentatricopeptide repeat-containing protein ... 70 8e-11 gb|EMS46552.1| hypothetical protein TRIUR3_15385 [Triticum urartu] 69 1e-10 ref|XP_012698183.1| pentatricopeptide repeat-containing protein ... 69 1e-10 ref|NP_001130403.1| uncharacterized protein LOC100191499 [Zea ma... 69 1e-10 ref|XP_008806008.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-10 ref|XP_020159715.1| pentatricopeptide repeat-containing protein ... 68 4e-10 ref|XP_010917048.1| PREDICTED: pentatricopeptide repeat-containi... 67 9e-10 gb|OAY78703.1| Pentatricopeptide repeat-containing protein, chlo... 66 1e-09 ref|XP_020091026.1| pentatricopeptide repeat-containing protein ... 66 1e-09 ref|XP_020586597.1| pentatricopeptide repeat-containing protein ... 66 2e-09 gb|PKA62360.1| Pentatricopeptide repeat-containing protein [Apos... 65 3e-09 >gb|ONK75443.1| uncharacterized protein A4U43_C03F16890 [Asparagus officinalis] Length = 378 Score = 77.4 bits (189), Expect = 1e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+VYGRRIVLRDLNRFHHFEGGVCSCGDYW Sbjct: 343 SMAKMVSMVYGRRIVLRDLNRFHHFEGGVCSCGDYW 378 >ref|XP_020257306.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g02980, chloroplastic-like [Asparagus officinalis] Length = 597 Score = 77.4 bits (189), Expect = 2e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+VYGRRIVLRDLNRFHHFEGGVCSCGDYW Sbjct: 562 SMAKMVSMVYGRRIVLRDLNRFHHFEGGVCSCGDYW 597 >gb|EAY92167.1| hypothetical protein OsI_13880 [Oryza sativa Indica Group] Length = 671 Score = 71.2 bits (173), Expect = 2e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW*KKRSY 126 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW S+ Sbjct: 576 SMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYWKDSESF 617 >gb|PAN44623.1| hypothetical protein PAHAL_I01197 [Panicum hallii] Length = 580 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 545 SMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 580 >gb|OEL36322.1| Pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 607 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 572 SMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 607 >gb|EAZ28899.1| hypothetical protein OsJ_12939 [Oryza sativa Japonica Group] Length = 611 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 576 SMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 611 >ref|XP_015632361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Oryza sativa Japonica Group] gb|AAT76420.1| putative PPR repeat containing protein [Oryza sativa Japonica Group] gb|ABF99332.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] dbj|BAF13460.1| Os03g0795200 [Oryza sativa Japonica Group] dbj|BAS86829.1| Os03g0795200 [Oryza sativa Japonica Group] Length = 611 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 576 SMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 611 >ref|XP_003557509.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Brachypodium distachyon] gb|KQK12722.1| hypothetical protein BRADI_1g05610v3 [Brachypodium distachyon] Length = 615 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 580 SMAKLVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 615 >ref|XP_006650721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Oryza brachyantha] Length = 601 Score = 70.1 bits (170), Expect = 6e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 566 SMAKFVSMVFNRRIILRDLNRFHHFEDGVCSCGDYW 601 >ref|XP_002466303.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Sorghum bicolor] gb|EER93301.1| hypothetical protein SORBI_3001G058400 [Sorghum bicolor] Length = 606 Score = 69.7 bits (169), Expect = 8e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE G+CSCGDYW Sbjct: 571 SMAKLVSMVFNRRIILRDLNRFHHFEEGICSCGDYW 606 >gb|EMS46552.1| hypothetical protein TRIUR3_15385 [Triticum urartu] Length = 547 Score = 69.3 bits (168), Expect = 1e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+++ RRI+LRDLNRFHHFE GVCSCGDYW Sbjct: 512 SMAKLVSMLFNRRIILRDLNRFHHFEDGVCSCGDYW 547 >ref|XP_012698183.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Setaria italica] ref|XP_022678818.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Setaria italica] ref|XP_022678819.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Setaria italica] gb|KQK86689.1| hypothetical protein SETIT_034766mg [Setaria italica] Length = 605 Score = 69.3 bits (168), Expect = 1e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE G+CSCGDYW Sbjct: 570 SMAKLVSMVFNRRIILRDLNRFHHFEDGLCSCGDYW 605 >ref|NP_001130403.1| uncharacterized protein LOC100191499 [Zea mays] gb|ACF78601.1| unknown [Zea mays] gb|AQK62363.1| Pentatricopeptide repeat-containing protein chloroplastic [Zea mays] Length = 606 Score = 69.3 bits (168), Expect = 1e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHFE G+CSCGDYW Sbjct: 571 SMAKFVSMVFNRRIILRDLNRFHHFERGICSCGDYW 606 >ref|XP_008806008.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Phoenix dactylifera] Length = 607 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ R+I+LRDLNRFHHFE G+CSCGDYW Sbjct: 572 SMAKLVSMVFDRKIILRDLNRFHHFENGLCSCGDYW 607 >ref|XP_020159715.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Aegilops tauschii subsp. tauschii] ref|XP_020159716.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Aegilops tauschii subsp. tauschii] ref|XP_020159717.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Aegilops tauschii subsp. tauschii] Length = 602 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+++ R+I+LRDLNRFHHFE GVCSCGDYW Sbjct: 567 SMAKLVSMLFNRQIILRDLNRFHHFEDGVCSCGDYW 602 >ref|XP_010917048.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Elaeis guineensis] Length = 607 Score = 66.6 bits (161), Expect = 9e-10 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 4 MAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 MAK S+V+ R+I+LRDLNRFHHFE G+CSCGDYW Sbjct: 573 MAKLVSMVFDRKIILRDLNRFHHFENGLCSCGDYW 607 >gb|OAY78703.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 405 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHF+ G+CSCG+YW Sbjct: 370 SMAKLVSMVFNRRIILRDLNRFHHFDKGLCSCGEYW 405 >ref|XP_020091026.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Ananas comosus] Length = 598 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK S+V+ RRI+LRDLNRFHHF+ G+CSCG+YW Sbjct: 563 SMAKLVSMVFNRRIILRDLNRFHHFDKGLCSCGEYW 598 >ref|XP_020586597.1| pentatricopeptide repeat-containing protein At2g02980, chloroplastic [Phalaenopsis equestris] Length = 592 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 +MAK S+V+GR+I+LRDLNRFHHF GG CSC DYW Sbjct: 557 AMAKLVSMVFGRKIILRDLNRFHHFAGGHCSCADYW 592 >gb|PKA62360.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 607 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 SMAKTASLVYGRRIVLRDLNRFHHFEGGVCSCGDYW 108 SMAK SL++GR+IVLRDLNRFHHF G CSCGD+W Sbjct: 572 SMAKMVSLLFGRQIVLRDLNRFHHFSHGECSCGDFW 607