BLASTX nr result
ID: Ophiopogon23_contig00006030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006030 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023921653.1| 40S ribosomal protein S29-like [Quercus suber] 82 4e-18 gb|PKI71371.1| hypothetical protein CRG98_008230 [Punica granatum] 82 4e-18 ref|XP_021660587.1| 40S ribosomal protein S29-like [Hevea brasil... 82 4e-18 ref|XP_021646796.1| 40S ribosomal protein S29-like [Hevea brasil... 82 4e-18 ref|XP_020234672.1| 40S ribosomal protein S29-like [Cajanus cajan] 82 4e-18 ref|XP_016177446.1| 40S ribosomal protein S29 [Arachis ipaensis] 82 4e-18 ref|XP_011078121.1| 40S ribosomal protein S29 [Sesamum indicum] ... 82 4e-18 ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumb... 82 4e-18 ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa a... 82 4e-18 gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] 82 4e-18 ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis ... 82 4e-18 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29 [Vitis ... 82 4e-18 ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer ... 82 4e-18 gb|AAT08693.1| ribosomal protein S29, partial [Hyacinthus orient... 82 7e-18 gb|EXB80035.1| 40S ribosomal protein S29 [Morus notabilis] 82 8e-18 ref|XP_024162060.1| 40S ribosomal protein S29-like [Rosa chinens... 81 9e-18 ref|XP_022888196.1| 40S ribosomal protein S29 [Olea europaea var... 81 9e-18 gb|PIN15268.1| 40S ribosomal protein S29 [Handroanthus impetigin... 81 9e-18 ref|XP_015938948.1| 40S ribosomal protein S29 [Arachis duranensis] 81 9e-18 ref|XP_015892836.1| PREDICTED: 40S ribosomal protein S29 [Ziziph... 81 9e-18 >ref|XP_023921653.1| 40S ribosomal protein S29-like [Quercus suber] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|PKI71371.1| hypothetical protein CRG98_008230 [Punica granatum] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_021660587.1| 40S ribosomal protein S29-like [Hevea brasiliensis] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_021646796.1| 40S ribosomal protein S29-like [Hevea brasiliensis] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_020234672.1| 40S ribosomal protein S29-like [Cajanus cajan] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_016177446.1| 40S ribosomal protein S29 [Arachis ipaensis] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_011078121.1| 40S ribosomal protein S29 [Sesamum indicum] ref|XP_011088056.1| 40S ribosomal protein S29 [Sesamum indicum] ref|XP_011092516.1| 40S ribosomal protein S29 [Sesamum indicum] ref|XP_011093855.1| 40S ribosomal protein S29 [Sesamum indicum] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] ref|XP_010261813.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] ref|XP_010277082.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] ref|XP_012093101.1| 40S ribosomal protein S29 [Jatropha curcas] ref|XP_017697791.1| PREDICTED: 40S ribosomal protein S29 [Phoenix dactylifera] ref|XP_018852113.1| PREDICTED: 40S ribosomal protein S29 [Juglans regia] ref|XP_019711246.1| PREDICTED: 40S ribosomal protein S29 [Elaeis guineensis] ref|XP_019710635.1| PREDICTED: 40S ribosomal protein S29 [Elaeis guineensis] ref|XP_020208011.1| 40S ribosomal protein S29 [Cajanus cajan] ref|XP_021688128.1| 40S ribosomal protein S29 [Hevea brasiliensis] ref|XP_024017223.1| 40S ribosomal protein S29 [Morus notabilis] ref|XP_024023455.1| 40S ribosomal protein S29 [Morus notabilis] gb|OAY39261.1| hypothetical protein MANES_10G080500 [Manihot esculenta] gb|OWM70796.1| hypothetical protein CDL15_Pgr014469 [Punica granatum] gb|PKI31245.1| hypothetical protein CRG98_048363 [Punica granatum] gb|PKI71641.1| hypothetical protein CRG98_007964 [Punica granatum] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] ref|XP_009404780.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] ref|XP_009421099.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] ref|XP_009386513.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] ref|XP_004289795.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] ref|XP_004290957.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] ref|XP_007143103.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] ref|XP_022942505.1| 40S ribosomal protein S29 [Cucurbita moschata] ref|XP_022952578.1| 40S ribosomal protein S29 [Cucurbita moschata] ref|XP_022922448.1| 40S ribosomal protein S29 [Cucurbita moschata] ref|XP_022927885.1| 40S ribosomal protein S29 [Cucurbita moschata] ref|XP_022984604.1| 40S ribosomal protein S29 [Cucurbita maxima] ref|XP_022985161.1| 40S ribosomal protein S29 [Cucurbita maxima] ref|XP_022989031.1| 40S ribosomal protein S29 [Cucurbita maxima] ref|XP_022972520.1| 40S ribosomal protein S29 [Cucurbita maxima] ref|XP_023540346.1| 40S ribosomal protein S29 [Cucurbita pepo subsp. pepo] ref|XP_023529847.1| 40S ribosomal protein S29 [Cucurbita pepo subsp. pepo] ref|XP_023551991.1| 40S ribosomal protein S29 [Cucurbita pepo subsp. pepo] ref|XP_023553866.1| 40S ribosomal protein S29 [Cucurbita pepo subsp. pepo] ref|XP_023909372.1| 40S ribosomal protein S29 [Quercus suber] ref|XP_024166095.1| 40S ribosomal protein S29 [Rosa chinensis] gb|ESW15097.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] gb|PRQ27817.1| putative ribosomal protein S14 [Rosa chinensis] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] ref|XP_002510113.1| PREDICTED: 40S ribosomal protein S29 [Ricinus communis] ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] ref|XP_008236441.1| PREDICTED: 40S ribosomal protein S29 [Prunus mume] ref|XP_008373047.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] ref|XP_008366503.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] ref|XP_008452633.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] ref|XP_008454386.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] ref|XP_008455027.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] ref|XP_009335389.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] ref|XP_009335391.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] ref|XP_009335395.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] ref|XP_009335396.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] ref|XP_012068241.1| 40S ribosomal protein S29 [Jatropha curcas] ref|XP_014512686.1| 40S ribosomal protein S29 [Vigna radiata var. radiata] ref|XP_014520214.1| 40S ribosomal protein S29 [Vigna radiata var. radiata] ref|XP_015579872.1| PREDICTED: 40S ribosomal protein S29 [Ricinus communis] ref|XP_016177041.1| 40S ribosomal protein S29 [Arachis ipaensis] ref|XP_017406681.1| PREDICTED: 40S ribosomal protein S29 [Vigna angularis] ref|XP_017413940.1| PREDICTED: 40S ribosomal protein S29 [Vigna angularis] ref|XP_020425405.1| 40S ribosomal protein S29 [Prunus persica] ref|XP_021832790.1| 40S ribosomal protein S29 [Prunus avium] ref|XP_022137207.1| 40S ribosomal protein S29 [Momordica charantia] ref|XP_022148695.1| 40S ribosomal protein S29 [Momordica charantia] ref|XP_022149134.1| 40S ribosomal protein S29 [Momordica charantia] gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] gb|KGN55257.1| 40S ribosomal protein S29 [Cucumis sativus] gb|KHN06796.1| 40S ribosomal protein S29 [Glycine soja] gb|KHN42324.1| 40S ribosomal protein S29 [Glycine soja] gb|OIW07926.1| hypothetical protein TanjilG_20027 [Lupinus angustifolius] gb|ONH91889.1| hypothetical protein PRUPE_8G141900 [Prunus persica] gb|PIM99804.1| 40S ribosomal protein S29 [Handroanthus impetiginosus] gb|PIN18038.1| 40S ribosomal protein S29 [Handroanthus impetiginosus] gb|PIN20471.1| 40S ribosomal protein S29 [Handroanthus impetiginosus] gb|PON54305.1| Ribosomal protein [Trema orientalis] gb|PON66003.1| Ribosomal protein [Parasponia andersonii] gb|PON74793.1| Ribosomal protein [Parasponia andersonii] gb|PON90565.1| Ribosomal protein [Trema orientalis] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] ref|XP_004511309.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] ref|XP_012570209.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gb|PIA33168.1| hypothetical protein AQUCO_04200137v1 [Aquilegia coerulea] Length = 56 Score = 81.6 bits (200), Expect = 4e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|AAT08693.1| ribosomal protein S29, partial [Hyacinthus orientalis] Length = 73 Score = 81.6 bits (200), Expect = 7e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 39 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 73 >gb|EXB80035.1| 40S ribosomal protein S29 [Morus notabilis] Length = 82 Score = 81.6 bits (200), Expect = 8e-18 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 48 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 82 >ref|XP_024162060.1| 40S ribosomal protein S29-like [Rosa chinensis] ref|XP_024162061.1| 40S ribosomal protein S29-like [Rosa chinensis] gb|PRQ22724.1| putative ribosomal protein S14 [Rosa chinensis] Length = 56 Score = 80.9 bits (198), Expect = 9e-18 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGIMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_022888196.1| 40S ribosomal protein S29 [Olea europaea var. sylvestris] ref|XP_022896152.1| 40S ribosomal protein S29 [Olea europaea var. sylvestris] ref|XP_022869260.1| 40S ribosomal protein S29 [Olea europaea var. sylvestris] ref|XP_022876317.1| 40S ribosomal protein S29 [Olea europaea var. sylvestris] Length = 56 Score = 80.9 bits (198), Expect = 9e-18 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|PIN15268.1| 40S ribosomal protein S29 [Handroanthus impetiginosus] Length = 56 Score = 80.9 bits (198), Expect = 9e-18 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_015938948.1| 40S ribosomal protein S29 [Arachis duranensis] Length = 56 Score = 80.9 bits (198), Expect = 9e-18 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_015892836.1| PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] ref|XP_015866898.1| PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] Length = 56 Score = 80.9 bits (198), Expect = 9e-18 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 105 RVCGNPHGLIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGIMCCRQCFRSNAKEIGFIKYR 56