BLASTX nr result
ID: Ophiopogon23_contig00003446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00003446 (1142 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271053.1| protein PIN-LIKES 3-like isoform X1 [Asparag... 45 9e-07 ref|XP_020271078.1| protein PIN-LIKES 4-like isoform X2 [Asparag... 45 9e-07 gb|ONK79012.1| uncharacterized protein A4U43_C01F1970 [Asparagus... 61 3e-06 >ref|XP_020271053.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] ref|XP_020271060.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] ref|XP_020271066.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] ref|XP_020271072.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] Length = 418 Score = 44.7 bits (104), Expect(2) = 9e-07 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = +2 Query: 941 DPLYHFILLLQYVAPPAMNISTFCLLYK 1024 DPLYHFILLLQY PPAMNI++ +++ Sbjct: 358 DPLYHFILLLQYAVPPAMNITSMVQMFE 385 Score = 38.1 bits (87), Expect(2) = 9e-07 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Frame = +1 Query: 787 IPSFHLTTGGNLTSGDDISPLFLELYLSDTV-----LTLVGIFIVRHAAHLVVV 933 IP HL TGGNLT G + + L + L L+GIFIV+ A HL +V Sbjct: 302 IPCIHLITGGNLTKGLQGPTIKFSIILGVMIVRYIALPLIGIFIVQWAVHLGLV 355 >ref|XP_020271078.1| protein PIN-LIKES 4-like isoform X2 [Asparagus officinalis] Length = 339 Score = 44.7 bits (104), Expect(2) = 9e-07 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = +2 Query: 941 DPLYHFILLLQYVAPPAMNISTFCLLYK 1024 DPLYHFILLLQY PPAMNI++ +++ Sbjct: 279 DPLYHFILLLQYAVPPAMNITSMVQMFE 306 Score = 38.1 bits (87), Expect(2) = 9e-07 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Frame = +1 Query: 787 IPSFHLTTGGNLTSGDDISPLFLELYLSDTV-----LTLVGIFIVRHAAHLVVV 933 IP HL TGGNLT G + + L + L L+GIFIV+ A HL +V Sbjct: 223 IPCIHLITGGNLTKGLQGPTIKFSIILGVMIVRYIALPLIGIFIVQWAVHLGLV 276 >gb|ONK79012.1| uncharacterized protein A4U43_C01F1970 [Asparagus officinalis] Length = 887 Score = 60.8 bits (146), Expect = 3e-06 Identities = 37/79 (46%), Positives = 44/79 (55%), Gaps = 8/79 (10%) Frame = +1 Query: 787 IPSFHLTTGGNLTSGDDISPLFLELYLSDTVLTLVGIFIVRHAAHLVVVQ--------FR 942 IP HL TGGNLT GD+ F+ TV+ LV I ++ H+ R Sbjct: 223 IPCIHLITGGNLTKGDNY---FI------TVVILVPFNIASNSRHIYSSMGSSSRPGALR 273 Query: 943 SFISFHSAATICCSACNEH 999 SFISF+SAATICCS CNEH Sbjct: 274 SFISFYSAATICCSTCNEH 292