BLASTX nr result
ID: Ophiopogon23_contig00003382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00003382 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253275.1| neutral/alkaline invertase 3, chloroplastic-... 78 1e-13 >ref|XP_020253275.1| neutral/alkaline invertase 3, chloroplastic-like [Asparagus officinalis] ref|XP_020253276.1| neutral/alkaline invertase 3, chloroplastic-like [Asparagus officinalis] ref|XP_020253277.1| neutral/alkaline invertase 3, chloroplastic-like [Asparagus officinalis] gb|ONK77610.1| uncharacterized protein A4U43_C02F8520 [Asparagus officinalis] Length = 521 Score = 78.2 bits (191), Expect = 1e-13 Identities = 41/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%) Frame = +3 Query: 300 MGVSDVSLQFLCGAAPSL-GLFSSTPNLTVPVNGHVKSKKKRGTLYLKGQSYTGIPTNCL 476 MG D+SL FLCGAA + GLF+ST LT P+ HVKS+KKR +++LK Q Y P+NCL Sbjct: 1 MGTCDMSLHFLCGAATTQSGLFASTSKLTAPLESHVKSRKKRSSVHLKYQIYARPPSNCL 60 Query: 477 RAVNGIAVDSGYCGNKLNN 533 VN + +++ Y G KL N Sbjct: 61 H-VNKLPINACYYGTKLRN 78